KEGG   Photorhabdus laumondii subsp. laumondii DSPV002N: A4R40_03290Help
Entry
A4R40_03290       CDS       T05478                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
plum  Photorhabdus laumondii subsp. laumondii DSPV002N
Brite
KEGG Orthology (KO) [BR:plum00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:plum03016]
    A4R40_03290
Enzymes [BR:plum01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     A4R40_03290
Transfer RNA biogenesis [BR:plum03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    A4R40_03290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AWK40612
Position
764002..764772
Genome map
AA seq 256 aa AA seqDB search
MLEVLYQDDHIVAVNKPAGWLVHRSWLARHETVFVMQTLRDQIGQHVFPVHRLDRPTSGV
LLMALSSDVARQLSQQFEHHQLQKTYHAVVRGYVLESAIIDYALVEELDKIADKFAEGDK
EAQSCVTYYRPLATVECPVEIGRYPTSRFSLLELTPKTGRKHQLRRHMAHIRHPIIGDTT
HGDLRQNRGVAVHYQTSRLMLHASYLELDHPVTGEKLSLTAKWDASWQHLIQQFGWQGII
PDLEYDEASKIENFID
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttggaagtgttataccaggatgatcatattgtggcagttaacaagccagcggggtgg
ttagttcatcgtagctggttggcgcgtcatgaaacggtctttgttatgcagacattgcgt
gatcagattggtcagcatgtttttccggtacaccgtctggatagaccaacgtctggcgta
ttgctgatggcgctttccagcgatgttgctcgccagctctctcaacagtttgaacatcat
caattacaaaaaacttatcatgctgtcgtgcgcggttatgtgttggaatcagctattatt
gattacgctttggttgaggagctggataagatcgccgataaatttgcagagggtgataaa
gaggcccaatcctgcgtgacttattaccgaccactggcaacggtggagtgtccggtagaa
ataggtcgttatcctacatcacgttttagtttgttggaattgacaccgaaaacaggtcga
aaacatcaattaagacgccatatggcacatattcgtcaccccattattggtgatacaaca
catggcgatttacggcaaaacagaggcgttgctgttcattatcaaaccagccggttaatg
cttcatgccagttatcttgagttggatcatcctgttacgggggagaaattatcgcttacg
gcaaaatgggatgcatcatggcagcatttaatacaacaatttggctggcaaggtattatc
cccgatttggaatatgatgaagcgagtaagatagaaaattttatagattag

DBGET integrated database retrieval system