KEGG   Photorhabdus laumondii subsp. laumondii DSPV002N: A4R40_10420Help
Entry
A4R40_10420       CDS       T05478                                 

Definition
(GenBank) acyl-CoA reductase
  KO
K03400  long-chain-fatty-acyl-CoA reductase [EC:1.2.1.50]
Organism
plum  Photorhabdus laumondii subsp. laumondii DSPV002N
Pathway
plum02020  Two-component system
plum02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:plum00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A4R40_10420
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A4R40_10420
Enzymes [BR:plum01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.50  long-chain acyl-protein thioester reductase
     A4R40_10420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LuxC Aldedh
Motif
Other DBs
NCBI-ProteinID: AWK41872
Position
2463106..2464548
Genome map
AA seq 480 aa AA seqDB search
MTKKISFIINGQVEIFPESDDLVQSINFGDNSVYLPILNNSHVKNIIDYNENNKLRLHNI
VNFLYTVGQRWKNEEYSRRRTYIRDLKKYMGYSEAMAKLEANWISMILCSKGGLYDVVEN
ELGSRHIMDEWLPQDESYIKAFPKGKSIHLLAGNVPLSGIMSILRAILTKNQCIIKTSST
DPFTANALALSFIDVDPNHPITRSLSVVYWPHQGDTSLAKEIMQHMDVIVAWGGEDAINW
AVEHAPPYADVIKFGSKKSFCIIDNPVDLTSAATGAAHDICFYDQRACFSAQNIYYMGNQ
YEEFKLALIEKLNLYAHILPNAKKDFDEKAAYSLVQKESLFAGLKVEVDVHQRWMIIESN
AGVEFNQPLGRCVYLHHVDNIEQVLPYVQKNKTQTISIFPWESAFKYRDALALRGAERIV
EAGMNNIFRVGGSHDGMRPLQRLVTYISHERPSHYTAKDVAVEIEQTRFLEEDKFLVFVP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaatttcattcattattaacggccaggttgaaatttttcctgaaagtgat
gatttagtgcaatccattaattttggtgataatagtgtttacctgccaatattgaataat
tctcatgtaaaaaacattattgattataatgaaaataataaattacggttgcataatatt
gtcaattttctctatacggtagggcaaagatggaaaaatgaagaatattcgagacgcagg
acatacattcgtgatttaaaaaaatatatgggatattcagaagcaatggccaagttagag
gccaactggatatctatgattttatgttctaaaggtggcctttatgatgttgtagaaaat
gaacttggttctcgccatatcatggatgaatggctacctcaggatgaaagttatattaag
gcttttccgaaaggtaagtctatacatctgttggcaggtaatgttccattatctgggatc
atgtctatattacgcgcaattttaaccaagaatcagtgtattataaaaacatcgtcaacc
gatccctttaccgctaatgcattagcgttaagctttatcgatgtagaccctaatcatccg
ataacgcgctctttgtctgttgtatattggccacaccaaggtgatacatcactcgcaaaa
gaaattatgcaacatatggatgttattgtcgcttggggaggggaagatgcgattaattgg
gctgtagaacatgcaccaccctatgctgacgtgattaaatttggctctaaaaagagtttt
tgcattattgataacccagttgatttaacgtcagcagctaccggcgcggctcatgatatt
tgtttttacgatcaacgcgcttgtttttctgcccaaaacatatattacatgggaaatcag
tatgaggaatttaagttagcgttgatagaaaaacttaatctatatgcgcatatattacca
aacgccaaaaaagattttgatgaaaaggcggcctattctttagtccaaaaagagagctta
tttgctggattaaaagtagaggtggatgttcatcaacgttggatgattattgagtcaaat
gcgggtgtggaatttaatcaaccacttggcagatgtgtgtatcttcatcacgtcgataat
attgagcaagtattgccttatgttcaaaaaaataagacacaaaccatatctatttttcct
tgggaatccgcatttaagtatcgagatgcgttggcattaagaggtgcggaaaggattgta
gaagcaggaatgaataatatatttcgagttggtggatctcatgacggaatgaggccgtta
caacgattagtgacatatatttctcatgagaggccatctcattatactgctaaggatgtt
gcggttgaaatagaacagactcgattcctggaagaagataagttccttgtatttgtcccg
taa

DBGET integrated database retrieval system