KEGG   Photorhabdus laumondii subsp. laumondii DSPV002N: A4R40_11255Help
Entry
A4R40_11255       CDS       T05478                                 

Definition
(GenBank) ketoglutarate semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
plum  Photorhabdus laumondii subsp. laumondii DSPV002N
Pathway
plum00040  Pentose and glucuronate interconversions
plum00053  Ascorbate and aldarate metabolism
plum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A4R40_11255
   00053 Ascorbate and aldarate metabolism
    A4R40_11255
Enzymes [BR:plum01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     A4R40_11255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AWK42022
Position
2640911..2642494
Genome map
AA seq 527 aa AA seqDB search
MLVTHSGRQFIGGRRQAEGERCLHSRRAVDNAPTGYAFYQATRHEVDLAAQAAADAFTRY
SQTSLEERAVFLDKIADEIDALGDDFIALVSEETALPPARIQGERSRTSGQMRLFATLLR
RGDMHAARIDTAQPARKPLPRVDIRQCHIPLGPIAVFGASNFPLAFSTAGGDTASALAAG
CSVVFKAHSGHMATAEIIAEAIGRAIIAAQMPAGVFNMIYGNSVGADLVKHPIIQAVGFT
GSLAGGRALFDMAMQRPQPIPVFAEMSSINPVIVLPNALAQRGKPIAQELANSFTLGSGQ
FCTKPGIILGIRSPEFDQFITQLTREITLRPAQSMLNQGTLLNYQKGIHQLDDEPLMTRL
AIGEHHENQASAMLYRADIALLLNKNALLQEEVFGPVAIVVEAESQYQLLRAIDCLQGQL
TATLIGEHDELANAHELSRRLQNIAGRVVVNGYPTGVEVCDAVVHGGPYPATSDVRGTSV
GTLAIWRFLRPVCFQNYPKSLLPLALQDHNPLNISRLINGVMSREVL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttggtaacacattcaggtaggcagtttattggtggtcgcaggcaagcagagggggaa
cgctgtttgcacagtcggcgggcggtggataacgcaccaacgggttatgcgttttatcaa
gctacacgacatgaggtcgatctcgccgcccaagccgccgccgatgcatttacccgttat
agccagacatcgttagaagaacgtgccgtttttttagataaaattgccgatgaaattgat
gctcttggtgatgacttcattgcccttgtatcagaagaaacggcgctaccaccagccaga
attcaaggtgaacggtcgagaaccagcgggcaaatgaggctgtttgccacgctgttacgc
cgtggtgatatgcatgctgcccgcattgatactgcgcaacctgcaagaaaacccctccct
agagttgatattcgccaatgccatattcctctaggccctattgcggttttcggtgccagt
aatttcccgttggctttttctactgctggtggtgacacggcgtcagcgttagcggcgggc
tgctctgttgttttcaaagcacatagtggccatatggctactgccgaaatcatcgcagaa
gccattggacgcgctattatcgccgcacaaatgcccgcgggtgtattcaatatgatttat
ggcaatagcgtgggggccgatctagtcaaacaccccattattcaggccgttggttttacc
ggttcacttgctggtggacgtgcactgttcgatatggcgatgcagcgaccacaacctatt
ccggtttttgctgaaatgtcgagtatcaacccggtcattgtgctgccaaacgccttagca
cagcgggggaaaccgatcgcccaagaactggcaaattcattcacattaggtagcggtcag
ttttgtaccaagccaggaataatcttgggtattcgttcaccagagtttgatcaatttatt
actcaattaacgcgggaaatcacgcttcgcccggcgcagtcaatgctgaaccaaggcaca
ttacttaactaccaaaaaggtattcatcaactggatgatgaacccttaatgacacggtta
gccattggcgaacatcatgaaaatcaggcaagtgcaatgttgtatcgtgcagatattgct
ttattgttgaataaaaatgctctgttacaagaggaggtttttggccctgttgctattgtg
gttgaagccgaaagccaatatcagcttttacgcgcaattgactgtttgcaggggcagctt
accgctaccttaattggtgagcacgatgaattagcgaatgcacatgagctcagtcgacga
ttacaaaacattgcgggcagggtggttgttaatggctacccgacaggcgttgaagtctgt
gatgccgtggttcatggcgggccttacccggcaacttccgatgtgagagggacttcagtt
ggtacactggccatctggcgttttctgcgcccagtctgcttccaaaactatcctaaatcc
ttacttccactcgcactgcaagaccataatccgttaaatatttctcgattaatcaatggg
gtgatgagccgggaagtgttgtaa

DBGET integrated database retrieval system