KEGG   Photorhabdus laumondii subsp. laumondii DSPV002N: A4R40_12680Help
Entry
A4R40_12680       CDS       T05478                                 

Definition
(GenBank) selenide,water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
plum  Photorhabdus laumondii subsp. laumondii DSPV002N
Pathway
plum00450  Selenocompound metabolism
plum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A4R40_12680
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:plum03016]
    A4R40_12680
Enzymes [BR:plum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     A4R40_12680
Transfer RNA biogenesis [BR:plum03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    A4R40_12680
 Prokaryotic Type
    A4R40_12680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AWK42291
Position
complement(2994961..2996004)
Genome map
AA seq 347 aa AA seqDB search
MSTEVRLTQYSHGAGCGCKISPKVLETILHSEQEKFLDPHLLVGNETRDDAAVYDIGNGT
GIISTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGKPIMAIAILGWPIDKLAPEIARKV
IEGGRAACKEAGIVLAGGHSIDAPEPIFGLAVTGIVNIDRVKQNSAAKVGSQLFLTKPLG
IGVLTTAEKKGLLLPEHQGIAIETMCRLNKLGMDFAEVAGITAMTDVTGFGLLGHLSEIC
AGSGVQATLHFAKVPKLPEVESYIAKGCVPGGTGRNFDSYGHLIGEMTELQRKLLCDPQT
SGGLLLAVLPEAMDEVKAIARCHGIELTAIGELSEQQSGRVLIEVNE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagaagttcgtcttacccaatacagccacggtgctggatgcggttgtaaaatt
tcaccaaaagttttggaaaccattctgcatagtgagcaggaaaaatttcttgatcctcac
ttactggttggtaatgaaacccgtgatgatgctgcggtttatgatattggcaatggtacc
ggcattatcagtacgacagatttcttcatgccgattgtcgatgatccatttgattttggg
cgcattgctgccacaaatgctatcagcgatatttatgcgatgggcggtaagcctattatg
gcgatagctatcttgggatggcctattgataaattagcgccggaaattgcccgtaaggtg
attgaaggtggccgggctgcgtgtaaagaggctgggattgtactggcaggagggcactct
attgatgcgcctgaacctatttttggtttggctgtaaccggtatcgttaatattgaccga
gtgaaacagaacagtgccgcgaaagtaggaagccagctatttctgaccaagccgcttgga
attggtgtattgaccaccgcggagaaaaaaggcttgctgttacctgaacatcagggaatt
gcgatagaaaccatgtgtcgcttaaataaattgggaatggattttgcggaagtggctggc
attacagcaatgaccgatgtaaccgggtttggtcttttaggccatttaagtgaaatttgt
gcaggatcgggggttcaggcaacactccattttgcaaaagtgcctaaattgccggaagtg
gaatcctatattgcaaagggttgtgttccggggggaaccgggcgtaactttgatagttac
ggtcatcttattggtgaaatgacagaacttcagcgcaaactgttatgtgatccgcaaacc
tccggtggcctgctgttggctgttctaccagaagctatggacgaagtgaaagcgattgca
cgatgtcatggcatcgaactgaccgcgattggtgaattgtctgagcaacagtcaggcaga
gtactcattgaggttaatgaataa

DBGET integrated database retrieval system