KEGG   Paenibacillus lautus: D5F53_04325Help
Entry
D5F53_04325       CDS       T05701                                 

Definition
(GenBank) nucleoid-structuring protein H-NS
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
plw  Paenibacillus lautus
Pathway
plw00360  Phenylalanine metabolism
plw00362  Benzoate degradation
plw00621  Dioxin degradation
plw00622  Xylene degradation
plw01100  Metabolic pathways
plw01120  Microbial metabolism in diverse environments
plw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:plw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    D5F53_04325
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D5F53_04325
   00622 Xylene degradation
    D5F53_04325
   00621 Dioxin degradation
    D5F53_04325
Enzymes [BR:plw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     D5F53_04325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: AYB42554
UniProt: A0A2A5LES2
Position
872409..873374
Genome map
AA seq 321 aa AA seqDB search
MIKSSQTKIVDCTIRDGGLVNNWDFSVEFVQNLYAGLNEAGVDYMEIGYKNSPKLLKGAD
QAGPWRFLDDEFLREVIPHKGKTKLSALVDIGRVDEDDILPREESLLDLIRVACYIKDVD
KALALVQTFHDRGYETTLNIMALSNVMENELLEAFEMIRESVVDVVYIVDSYGSLDHKDM
EYLVNKFKTHLPNKRLGVHTHNNMQLAFSNTLVAADLGVELLDASVYGMGRAAGNCPTEL
LVTHLKGTKYELRPVLDIIERFMIPLREKEEWGYIMPYMITGTLDEHPRSAMALRASDDK
DKIVDFYDKLTTPEVTFDKKK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaagagtagtcagacaaagattgtagactgtaccattcgcgatggcggactggtg
aacaactgggattttagcgtagaattcgtgcaaaatttatatgcaggcctgaatgaggct
ggcgtagactatatggaaatcggttataaaaattcgcctaagctgctaaaaggcgctgac
caagccggcccttggcgttttttggatgatgaattccttcgagaagttattccccataaa
ggtaaaaccaagctgtccgcgctggtcgatatcggccgggtggatgaggatgatattttg
ccgcgcgaggagagcctgctggatctcatccgcgttgcgtgctacatcaaagacgtggat
aaagcgctcgcgctggttcagaccttccatgatcgcggttacgagacgacgctgaacatt
atggccctctccaacgtgatggagaatgagctgctggaagcttttgagatgatcagggag
agcgtcgtggatgtggtgtacatcgtcgattcttacggaagcctggatcataaggacatg
gaatacctggtaaataagttcaagacgcatctgccgaacaaacgtctgggcgttcatacc
cataacaatatgcagctggcgttctccaacacgctggtggccgccgacctcggcgttgaa
ctcctggatgcatccgtgtacggcatgggccgcgcagccggcaactgtccgaccgagctt
ctggttacccacttgaaaggcacgaagtacgagctgcgcccggtgctggatatcattgag
cgcttcatgatccctcttcgcgaaaaagaggagtggggttacatcatgccctacatgatt
acaggcaccctggacgaacatccacgctctgccatggcacttcgcgcttcggatgataaa
gacaaaattgtggatttttacgataaattgacgacaccggaagtgacgttcgacaaaaag
aagtaa

DBGET integrated database retrieval system