KEGG   Paenibacillus lautus: D5F53_04855Help
Entry
D5F53_04855       CDS       T05701                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
plw  Paenibacillus lautus
Pathway
plw00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:plw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D5F53_04855
Enzymes [BR:plw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     D5F53_04855
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     D5F53_04855
    1.1.1.-  
     D5F53_04855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C Shikimate_DH ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AYB42652
UniProt: A0A385TJ63
Position
989797..990846
Genome map
AA seq 349 aa AA seqDB search
MQALRWHGVKDLRLETIAEPQATNGKVKIKVEWCGICGSDLHEYVAGPIFIPENTPHALT
GEQAPVVMGHEFSGQVVEVGEGVTKFKAGDRVVVEPVFACGSCEACRQGKYNLCDKMGFL
GLAGGGGGFSEYVAADEHMVHKIPDSVSYEQGALVEPSAVALYAVRQSQLKAGDRAVVFG
AGPIGLLVIEALKAAGASEIYAVELSPERKQKAEELGAIVIDPKAFDVVEELHRRTGTGV
DVAFEVTGVPPVLTQAINSTKIGGQIMIVSIFETSAPIVPNDIVMKERNITGIIGYRDVF
PAVISLMEKGFFPADKLVTQRIKLDEVIDRGFEALLKEKNQVKILVSAH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcattgcgctggcatggagtaaaggacctgcgtttggagacgatcgcggagccg
caagctacgaacggaaaagtgaaaatcaaggtcgagtggtgcgggatttgtggcagtgat
ctgcacgaatacgtggccgggcctatatttatacctgagaatacgcctcacgcccttacc
ggagaacaggctccggtggtgatgggccatgagttttccggccaggttgtagaggttggc
gaaggcgttacgaaattcaaggctggcgaccgggtggttgtggagcctgtctttgcatgc
ggatcttgcgaagcttgcagacaagggaaatataatctgtgcgacaaaatgggctttctc
gggctcgccggcggaggcggtggattctccgaatatgtagccgcggatgagcacatggtt
cataaaattccggacagcgtttcatatgaacagggagctcttgtggagccttcggcagtc
gcgctgtacgccgtgcgccaaagccagctgaaggccggagatcgggcggtggtattcggt
gccggaccgatcggcctgcttgtcatcgaagcattgaaggcagcgggggcatccgagatt
tacgccgtggagctgtccccggagcgcaaacagaaagcggaggaattgggggcaatcgtc
attgatccgaaggccttcgatgtggtagaagaacttcatcgccgtaccggtaccggggtc
gatgtggcattcgaggtgaccggggttccgcctgttcttacccaagcgatcaactcgacg
aagatcggcggacagattatgattgtcagcatcttcgaaacctccgctccgatcgtgccg
aatgacatcgtgatgaaggagcgtaacatcaccggaatcatcggctatcgcgatgtattc
ccggctgtcatcagcctgatggaaaaaggcttcttcccggcggacaagctggtcacccag
cggatcaaactggatgaggttatcgaccggggctttgaggccctgctcaaagagaagaat
caggtgaagatcctggtgagcgcacactaa

DBGET integrated database retrieval system