KEGG   Paenibacillus lautus: D5F53_10060Help
Entry
D5F53_10060       CDS       T05701                                 

Definition
(GenBank) tRNA glutamyl-Q(34) synthetase GluQRS
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
plw  Paenibacillus lautus
Pathway
plw00860  Porphyrin and chlorophyll metabolism
plw00970  Aminoacyl-tRNA biosynthesis
plw01100  Metabolic pathways
plw01110  Biosynthesis of secondary metabolites
plw01120  Microbial metabolism in diverse environments
Module
plw_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:plw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D5F53_10060
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D5F53_10060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:plw01007]
    D5F53_10060
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:plw03016]
    D5F53_10060
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:plw02048]
    D5F53_10060
Enzymes [BR:plw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     D5F53_10060
Amino acid related enzymes [BR:plw01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   D5F53_10060
Transfer RNA biogenesis [BR:plw03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    D5F53_10060
 Prokaryotic Type
   Other AARSs
    D5F53_10060
Prokaryotic defense system [BR:plw02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    D5F53_10060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AYB43611
UniProt: A0A385TJE3
Position
complement(2132186..2133163)
Genome map
AA seq 325 aa AA seqDB search
MEQQATFRGRFAPTPSGKMHIGNALTALLGWLQMRSMNGQYILRIEDIDVQRSRQELANE
IMRDLEWLGLDWDEGPGVGGAYGPYHQAARHALYEREIAKLKESNMLYPCYCSRADITAA
ASAPHGIASEGFRYPGTCRELTREEAALKELHKKPSLRMKVPHRGISFVDGIAGVQRYRL
SDGGDFVVRRADDIISYQLAVVVDDALMGITHVLRGADLLDSTPRQLLLYEALSYQPPQF
AHTPLMVDAEGRRLAKRTRGLSLSFLRGQGITPERLTGWLAWTAGLLDHPEAVTPAELIP
VFDLSKVSSFPIKITDHVKNRLFEP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcaagccacatttcgcggccgctttgcccctacgccatcaggtaagatgcat
atcggcaatgcattgaccgctttgcttggatggctgcaaatgaggagtatgaacggtcaa
tatatactccgaatcgaagatatcgatgtgcagcgttcccgccaagagctcgcaaacgag
atcatgagagatctggaatggctcggtttggattgggatgaaggccccggcgtcggcggg
gcttacggaccgtatcatcaggctgcacgccacgcgctgtacgaacgggaaatcgccaaa
ttgaaggaatcgaatatgttgtacccctgctactgcagccgggcggatataaccgcagca
gccagcgcaccgcatggcattgcctcggagggatttcgctatccgggaacctgccgggag
ctgacccgggaggaagctgccctgaaagagcttcataagaaaccttcgctgcgcatgaag
gtgccgcacagaggcatatcctttgttgacggcattgccggggtgcagcgctaccggcta
tccgacggcggggattttgtcgtacggagagccgacgatatcatttcgtatcaactcgcg
gtggtggtcgatgacgcgctaatgggcattacccatgtgctccgaggagctgatctcctg
gactccacccctcgtcagctgctattgtatgaagcgctgtcttaccaaccgccgcagttt
gcacacacaccgctgatggtggatgcggagggcaggcggctggccaagagaacccgcggg
ctcagcctctcctttctgcgaggccagggcatcacgccggaacgcttaaccggctggctg
gcatggacagccggccttctggatcacccggaagcagtaactcccgctgaattgatccct
gtttttgatttatcgaaagtttcttcattccccataaaaattacggatcatgttaaaaac
cggctgttcgagccttaa

DBGET integrated database retrieval system