KEGG   Paenibacillus lautus: D5F53_15765Help
Entry
D5F53_15765       CDS       T05701                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
plw  Paenibacillus lautus
Pathway
plw00020  Citrate cycle (TCA cycle)
plw00620  Pyruvate metabolism
plw01100  Metabolic pathways
plw01110  Biosynthesis of secondary metabolites
plw01120  Microbial metabolism in diverse environments
plw01130  Biosynthesis of antibiotics
plw01200  Carbon metabolism
Module
plw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:plw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D5F53_15765
   00620 Pyruvate metabolism
    D5F53_15765
Enzymes [BR:plw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     D5F53_15765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO HI0933_like Pyr_redox_2 MbeD_MobD DUF2914
Motif
Other DBs
NCBI-ProteinID: AYB44640
UniProt: A0A385TJG5
Position
complement(3415443..3416942)
Genome map
AA seq 499 aa AA seqDB search
MSNMEKKTDVILIGAGVMSATLGALLKELVPEWEIKVFEKLASAGEESSNEWNNAGTGHS
ALCELNYTSEKPDGSIDISKAISINEQFQVSRQFWSYLVSSNLIRNPQDFIMPIPHMSLV
QGEKDVAFLKKRFEALSNHPLFQGMEYSEDSEQLKEWIPLIMEGRTSNEPLAATKIDSGT
DINFGALTRMLFEHLKNKDVEVNYKHSVKDIKRTPDGSWKVKVLDNNNGRTEFHTAKFVF
IGGGGGSLHLLQKTGIPESKHIGGFPVSGLFMVCKNQEVVAQHHAKVYGKAKVGAPPMSV
PHLDTRYIDNQKALLFGPFAGFSPKFLKTGSNFDLISSVKPNNVFTMLAAGVKEMALTRY
LIQQVVLSNEKRMEELREFIPNAKSEDWEIVVAGQRVQVIKDTANGKGTLQFGTEVVSAA
DGSVAALLGASPGASTAVHVMLEVLQKCFPQQMKEWEPKIKEMIPSFGMSLSKNPALFEE
IQDTTSETLGLSLKALVHS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatggagaaaaaaacagacgtaatcttgattggtgccggcgtcatgagcgcg
acattgggagccttactgaaggagctggtgcccgaatgggagatcaaagtgttcgagaaa
ctcgcaagcgcgggggaagaaagctccaatgaatggaataatgcggggaccggccattcc
gcactatgcgagcttaactatacgtccgaaaaacctgacggatctatagacatcagcaaa
gcgatcagcatcaacgagcagtttcaggtttcacgtcagttctggtcttatctggtaagc
agcaatctgattcgcaatccgcaggactttatcatgcctatacctcatatgagtttggtt
cagggtgaaaaagacgtggcttttttgaaaaaacgttttgaagcgctgtcaaatcatcct
ctctttcaaggaatggaatattccgaggattccgagcagctgaaggaatggattccgctt
attatggaagggcgcacatcaaacgaaccgttagcggcaaccaaaatcgattccgggacg
gacattaactttggcgctttaacgcgcatgctgtttgagcatctgaagaacaaagacgtc
gaggtcaactacaagcatagcgtgaaggatattaagcgtactcccgatggctcgtggaaa
gtaaaagtgttggataacaataacggcagaaccgagtttcatacggccaaattcgttttt
atcggtggtggaggcggcagcctgcatctattgcaaaagaccggcattcccgaatccaag
catatcggtgggttcccggtgagcggactgttcatggtctgcaagaatcaagaagtcgtt
gcacagcatcatgccaaggtatacggaaaagccaaggttggcgctcctccgatgtcggtg
ccccatctggacacaagatacatcgataaccaaaaagcactgctcttcggtccgtttgcc
ggcttctcgccgaagttcctaaaaacgggttcgaatttcgatttgatcagttcagtcaaa
ccgaataatgtcttcacgatgctggcggcaggagtgaaagaaatggccttgacccgatac
ctgatccagcaggtggtgctatcgaatgagaagcgtatggaagaactgcgcgagtttatc
ccgaacgcgaagagcgaggattgggaaatcgtcgtggcgggccaacgcgtgcaagtcatt
aaagatacggctaatggaaagggcacgctgcaattcgggaccgaagtggttagtgccgcg
gatggctcggtcgcagcactgcttggtgcttcaccaggggcttcgacggccgtacacgtg
atgctggaggtattgcagaaatgcttcccgcagcagatgaaggaatgggaaccgaaaatc
aaggaaatgattccttctttcgggatgtcgctttcaaagaatccggccctcttcgaagaa
attcaagatacaacttcagaaacgctaggtttaagcttaaaagcactggtgcatagttaa

DBGET integrated database retrieval system