KEGG   Paenibacillus lautus: D5F53_18390Help
Entry
D5F53_18390       CDS       T05701                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
plw  Paenibacillus lautus
Pathway
plw00361  Chlorocyclohexane and chlorobenzene degradation
plw00625  Chloroalkane and chloroalkene degradation
plw01100  Metabolic pathways
plw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:plw00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    D5F53_18390
   00361 Chlorocyclohexane and chlorobenzene degradation
    D5F53_18390
Enzymes [BR:plw01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     D5F53_18390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Acid_phosphat_B
Motif
Other DBs
NCBI-ProteinID: AYB45129
UniProt: A0A385TN26
Position
complement(4024974..4025669)
Genome map
AA seq 231 aa AA seqDB search
MEMRYKAVIFDLDNTILDYSQSEKKCMQQALEHYRLHEDLTWDEFWGTFGPINFKYWMNR
IQHNYDIRQVLEHSFTDTFLGLKREFNQYREISETYWGLFCSSHHLEPHADLILEHLHGD
FALGVISNGIGEAQRKRLAAGGLFHYFDSFIISDEVKYWKPDPQIFKLALQELALGPTEV
LYIGDSLTDDYEGAAKAGIDFCYYNRRGAPLSDRHRPAYMIKDLLEVKDLV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggagatgagatacaaggccgttatttttgatctggacaacacgatattggactacagt
cagagcgaaaagaagtgcatgcagcaggccctggagcattaccgtctgcatgaggatttg
acgtgggatgaattctgggggacattcggaccgatcaattttaaatactggatgaaccga
attcagcataattacgacattaggcaggtgttggagcactccttcacggacacgttcctt
ggtttgaagcgggaatttaaccagtaccgggagatctcggaaacatactgggggttattt
tgcagttcccaccatttggagccgcatgccgatctcatattggagcacctgcatggcgac
tttgcactcggggtgatctccaacggcattggcgaagcacagcgcaaacgccttgcggca
ggaggcttgtttcattattttgactccttcatcatttcggatgaagtaaagtactggaag
ccggatccgcaaatctttaagcttgcgttgcaggaattagcgcttggcccaaccgaagtg
ctgtacataggcgattcgcttacggatgattacgaaggagcagcgaaagcaggaattgat
ttttgttattataatcgccggggcgcccctttaagcgaccgtcatcgacctgcttatatg
atcaaggatcttctggaggtcaaggatctggtttag

DBGET integrated database retrieval system