KEGG   Paenibacillus lautus: D5F53_24645Help
Entry
D5F53_24645       CDS       T05701                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
plw  Paenibacillus lautus
Brite
KEGG Orthology (KO) [BR:plw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    D5F53_24645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1 TMEM72 Nbas_N
Motif
Other DBs
NCBI-ProteinID: AYB46288
UniProt: A0A385TT40
Position
complement(5429527..5430516)
Genome map
AA seq 329 aa AA seqDB search
MDTTMLVLVIVVFLALAFDFINGFHDTANAIATSVSTRALKPRVAILLAASMNFVGAMMF
TGVAKTIGGSVADPAKLDNGIEVVIATLLAAIIWNLVTWWFGLPSSSSHALIGALAGAVF
VGAGSDMLNYGGFKDIVLALILSPIIAFVIGYLVMQLLKVIFAKRSPHTVNKGFRTMQIF
TAALQSFTHGTNDAQKAMGIITFALVTSGQLQEMEVPFWVKVSAATAMALGTSVGGWKII
KTMGTKIFKIEPINGFAADFSAASVIFSATLLHLPISTTHAITSAILGVGSAKRFSAVKW
SLAGRIVVTWFITIPITAVLAGVIFKILF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggatacaacgatgttagtattagtaatagttgtttttttggcgcttgcatttgacttc
atcaacgggttccacgatacggcgaatgccattgcgacgtcggtatcgacccgggccctg
aagccgcgggtagccatactgctcgcagcgagcatgaacttcgtcggcgcgatgatgttc
acgggcgttgccaaaaccatcggcggcagcgtcgcggatccggccaagctggataacggg
atcgaggttgttattgcaacattgcttgcagcaatcatctggaacctggttacctggtgg
ttcggattgccttcgtcctcttcccatgccctaatcggggcattggccggcgcagtattc
gtcggtgcgggaagcgacatgctgaattacggcggattcaaggacatcgtgcttgcgttg
atcctgtcgccgattatcgcattcgtgatcggttatctggtcatgcagctgctcaaggtc
atctttgccaagcgcagtccgcatacggtgaacaagggcttccgtacgatgcagatcttc
acggcagcgctgcaatccttcacgcacggtaccaacgacgctcagaaggcaatgggtatt
attacttttgctctcgtgacgtccggtcaattgcaggagatggaagtacccttctgggtt
aaagtctctgcggcaaccgcgatggcgctcggtacgtcggtaggcggctggaagatcatc
aagaccatgggtacgaaaatattcaaaatcgagccgatcaacgggttcgccgccgatttc
tcggctgcctccgttatcttctcggccactttgcttcacttgccgatcagtacaacgcat
gccattacgtcggcaattctcggcgtaggctcggcaaaacgcttctctgccgtaaaatgg
tccttggcaggacgcatcgtggtaacctggtttattacgattccgattacggccgtactg
gcaggagtcatctttaaaattcttttctag

DBGET integrated database retrieval system