KEGG   Paenibacillus lautus: D5F53_31095Help
Entry
D5F53_31095       CDS       T05701                                 

Definition
(GenBank) DJ-1/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
plw  Paenibacillus lautus
Brite
KEGG Orthology (KO) [BR:plw00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    D5F53_31095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:plw01002]
    D5F53_31095
Enzymes [BR:plw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     D5F53_31095
Peptidases [BR:plw01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   D5F53_31095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI GATase_3 GATase
Motif
Other DBs
NCBI-ProteinID: AYB47476
UniProt: A0A385TUM4
Position
complement(6873526..6874131)
Genome map
AA seq 201 aa AA seqDB search
MKMAFILFHGMTALDLIGFTEVMTRLARIRPESDISWDYCALSTQITDDRGLAYVVSRVK
PDLSEYDLLFVPGGFTTRELRYDPDVLTWLQTAREANHLVSVCTGSLLLGAAGLLEGKRA
TTNASAYELLTPYCKEVVQARIVQDGRLFTGSGVSSSIDLGLYVLERLTDAATAERVQTD
MSYPYYRTGTSSAVYDAKTGM
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggctttcattctattccatggcatgacggcgctggacctgatcggcttcacc
gaagtcatgacccggcttgcccgcatccgtcccgaatcggatatatcctgggattattgc
gcgttgagcacgcaaatcaccgatgatcgcggattggcgtatgtcgtatcccgggtcaaa
ccggatctttcggaatacgatctgctcttcgtgcctggcggctttaccacgagggagcta
agatacgaccccgatgtgctgacttggctgcagaccgcccgggaagccaaccatctcgta
tccgtctgcaccggatcgctgcttttgggcgcggccggcttgctggagggcaagcgggct
accaccaacgcttcggcttacgagctattgacaccctactgcaaggaagttgttcaagca
cgcattgtacaggacggccgtctctttacgggcagcggagtgtcttcgtctattgatctc
ggcctatatgtgctcgaaaggctaaccgatgcagcaacggcggaacgggtgcagacggat
atgagctacccctattaccggacgggaacctcatccgcggtatatgatgcgaagacaggc
atgtga

DBGET integrated database retrieval system