KEGG   Planococcus sp. MB-3u-03: CW734_01385Help
Entry
CW734_01385       CDS       T05387                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
plx  Planococcus sp. MB-3u-03
Pathway
plx00450  Selenocompound metabolism
plx00970  Aminoacyl-tRNA biosynthesis
plx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CW734_01385
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CW734_01385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:plx01007]
    CW734_01385
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:plx03016]
    CW734_01385
Enzymes [BR:plx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CW734_01385
Amino acid related enzymes [BR:plx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CW734_01385
Transfer RNA biogenesis [BR:plx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CW734_01385
 Prokaryotic type
   Other AARSs
    CW734_01385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 Zn-ribbon_8 zf-Mss51
Motif
Other DBs
NCBI-ProteinID: AUD12545
Position
45619..47580
Genome map
AA seq 653 aa AA seqDB search
MTAKNKTFYLTTPIYYPSGKFHIGTAYTTVASDAMARYKRLRGFDVRFLTGMDEHGQKIE
EKAREAGKEPQVFVDDMAEAAKKVWEVMDISYDDFIRTTEARHKEGVEKIFQTFLDNGDI
YKGEYEGWYCTPCESFFTESQLEDGNCPDCGRPVHKVKEESYFFNMKKYADRLLDYYDKH
VEFIEPESRKNEMVNNFIKPGLEDLSVSRTSFDWGIPVPGDPKHVIYVWVDALSNYITSL
GYGSNDDSSFNKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKVFAHGFIMMKDGK
MSKSKGNVVYPEMLVERYGLDAARYFLLRELPFGSDGVFSPESFVERTNYDLANDLGNLL
NRTVSMINKYFDGEVPQVDGFKTDFDETLQTIAKNTVAVYEEHMEKMQFSLVLSEVWTLI
SRTNKYIDETQPWVLAKEDGDRTQLASVMAHLAESLRMTAVMLQPFLPNAPKQIIEQLGL
TPEFLEWQTLESFGAIPAGTTVVKKGTPIFPRLEVEPEVAYIRDQMRGGAAPKEEPAQTV
PEKPDTPEITIDDFMKVDLRVATVTACEPVKKTDKLLKLQVDMGYETRQVVSGIAEHYKP
DELVGQKVIIVANLKPVKLRGELSQGMILAGQQNGYLTIASVDQKLPNGTQVK
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccaagaacaagacattttacctgacgactcccatttactatccgagcggaaaa
ttccatatcggaacggcttacacgaccgttgcatccgatgcaatggcgcgctataaacgc
ctgcgtggcttcgatgtccgttttttgacgggcatggacgaacacggccagaaaattgaa
gaaaaagcccgcgaagccggcaaagaaccgcaagtctttgtcgatgacatggcagaagcg
gcgaaaaaagtatgggaagtcatggacatcagctatgacgattttatccgtacgactgaa
gcccgccacaaggaaggtgtggagaaaattttccaaaccttcctcgacaatggcgatatt
tacaaaggggaatacgaaggctggtattgcacgccttgcgaatccttcttcacggaatcg
cagctcgaagacggcaattgcccggattgcggacgcccggtgcataaagtgaaagaagaa
tcgtatttcttcaatatgaaaaagtacgcagaccgcttgcttgattattacgataagcat
gttgagttcatcgaaccggaatcgcgcaaaaatgaaatggtcaataatttcatcaagccg
ggccttgaagatttgtctgtttcccggacttcattcgactggggcatcccggttcctgga
gatccgaagcatgtcatctatgtatgggtcgatgcgttgtcgaattacatcacctcactt
ggctacggctcgaatgacgattccagtttcaataaatactggccggcggatgtccacgtc
gtcggaaaagacatcgtgcgcttccatacgatctattggccgatcttcctcatggcgctt
gacttgccgttgccgaagaaagtattcgcacacggcttcatcatgatgaaagacggcaaa
atgtcgaaatcgaaaggcaatgtcgtctatccggaaatgctcgtggagcgttacgggctg
gatgcggcgcgttatttcctattacgcgagctaccattcggatccgatggcgtgttctct
ccggaatccttcgtcgagcgcaccaattatgacttggcgaacgacctcgggaatctattg
aaccgcaccgtttcgatgatcaataaatatttcgacggcgaagtgccgcaagtcgacggc
ttcaagaccgatttcgatgagactttgcagaccatcgcgaaaaacacagtcgctgtctac
gaagaacatatggaaaaaatgcagttcagccttgtgttaagcgaagtgtggacattgatt
tcccgcacgaataaatatatcgatgaaacgcagccgtgggtattggcaaaagaggatggc
gaccgcacgcaactcgcgtcggtcatggcgcatctcgccgagagcttgcgcatgacggcc
gttatgctgcagccgttcttgccgaatgcaccgaagcaaattatcgagcagctcgggctg
acgccggaattccttgaatggcagacattagagtcattcggcgcgattcctgcaggtacg
accgtcgtgaaaaaaggcacgccgattttcccgcgtctcgaagtggagccggaagtggcc
tatattcgcgaccaaatgcgcggaggggcagcgccgaaagaagagcctgcccaaaccgtt
cctgaaaagccggacacccctgagattacgattgatgatttcatgaaagtggatttacgc
gtggcgacggttacggcatgtgaaccggtgaagaagaccgataagctgttgaagcttcaa
gtggacatgggctatgaaacgcgccaagtcgtctccggcatcgccgaacattacaagccg
gatgaactggtcggccaaaaagtcatcattgtcgccaacttgaaaccggtcaagctgcgc
ggtgaattatcgcaaggcatgattcttgccggacagcaaaatggttacttgaccatcgct
tccgtagaccaaaagttaccgaacggcactcaagtcaagtaa

DBGET integrated database retrieval system