KEGG   Planococcus sp. MB-3u-03: CW734_13385Help
Entry
CW734_13385       CDS       T05387                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
plx  Planococcus sp. MB-3u-03
Pathway
plx00051  Fructose and mannose metabolism
plx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CW734_13385
Enzymes [BR:plx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     CW734_13385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AUD14459
Position
complement(2411910..2413115)
Genome map
AA seq 401 aa AA seqDB search
MKQAIHFGAGNIGRGFIGALFSESGYHVSFVDVAEQVIDGLNEQGQYRVNMAQETEESVL
VENVSGINNMKDEEAVIAKIQQATYLTTAIGPNILPRIAPLIAKGIEARVKGSLASGPDL
VPASDLDVATDMSAGSEKLYIIACENQIGATDILKGHILSHLSDEAKADLAGKVYFFNSA
VDRIVPIQEGHSLDVLVEPYYEWVVETTEDIPHVSGMTIVDDLAPFIERKLFTVNTGHAV
IAYYGYLASKTTIDETLADPEIEREVRETLKETGAYLVKQYGLDEQEHLAYIDKNIERFK
NAYLNDGVTRVGRAPIRKLGPEDRLVRPAVQAQKAGLSYSHLAKAIAAALLFDYAEDEEA
VKIQEMIAQGGPERVLTEVSGLEADSELAKEVVRQYGALKK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcgatccattttggagcaggaaatatcggcagagggtttatcggggcgttg
ttctcggaatccggctatcacgtgagtttcgtcgatgtggcggaacaagtcatcgacggg
ttgaatgaacaaggccagtaccgcgtgaatatggcgcaggagacggaagagagcgtcttg
gtggagaatgtgtcgggcatcaataatatgaaagacgaagaagcggtcatcgcgaagatc
cagcaagcgacgtatttgacgacggcgatcgggccgaacattttgccgcgcattgcgcca
ttaatcgcaaaagggattgaagcgcgcgtgaaaggcagtttggcgtctggaccggatttg
gtgccggcgtctgatttggatgtggcgacggacatgagcgcgggttcggaaaaattatac
atcattgcctgtgaaaaccagatcggcgcgaccgatattttgaaaggacatatcttaagc
catttgagcgacgaagcgaaagcggatctcgccggcaaagtgtatttctttaattcagcg
gtcgaccgcatcgtaccgatccaggaaggccattcacttgatgtattggtcgagccttat
tacgaatgggtcgtcgagacgacagaagacattcctcacgtgtccggcatgacgattgtc
gacgacttggcgccgttcattgagcgcaagctgtttacggtcaatacggggcacgcggtc
atcgcgtattacgggtatctcgccagcaaaacgacgatcgatgaaaccttggccgatccg
gaaatcgaacgcgaagtgcgggaaaccttgaaagagacgggcgcgtacctcgtgaagcag
tacggcttggacgaacaggagcatctcgcatatatcgataaaaacatcgaacgcttcaaa
aacgcctatttgaacgacggtgtcacgcgcgtcggccgcgcgccgatccgtaagctcggg
ccggaagatcgcctcgtgcgcccggctgtgcaagcgcaaaaagcgggattgtcgtattca
catctcgccaaagcgatcgcggcggcgctgctgttcgattatgcagaagacgaagaagcg
gtgaaaatccaagagatgatcgcacaaggcgggccggagcgcgtattgacagaagtcagc
gggctcgaagccgatagcgaactggcgaaagaagtcgtgcgccagtatggggcattgaaa
aagtag

DBGET integrated database retrieval system