KEGG   Pseudoalteromonas luteoviolacea: S4054249_06200Help
Entry
S4054249_06200    CDS       T04577                                 

Definition
(GenBank) hypothetical protein
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
plz  Pseudoalteromonas luteoviolacea
Pathway
plz00473  D-Alanine metabolism
plz01100  Metabolic pathways
plz01503  Cationic antimicrobial peptide (CAMP) resistance
plz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:plz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    S4054249_06200
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    S4054249_06200
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    S4054249_06200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:plz01504]
    S4054249_06200
Enzymes [BR:plz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     S4054249_06200
Antimicrobial resistance genes [BR:plz01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    S4054249_06200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding PP-binding_2
Motif
Other DBs
NCBI-ProteinID: AOT07455
Position
1:complement(1428554..1428811)
Genome map
AA seq 85 aa AA seqDB search
MSLARNIENTIYQTLIEKHGEDITNTINKDESLITAGLLDSMDFITMLMNLENTFDIDID
FEDVDPVSFTAINGLVKLLSEQENA
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgagcttagcaagaaatattgaaaatactatttatcaaacattgattgaaaaacatggt
gaagacattaccaatactattaataaggacgagagcctaataactgcaggtttgttagac
tccatggactttataacgatgctgatgaatcttgaaaacacgtttgatattgatatcgat
tttgaggacgtcgaccctgtctcttttaccgcgataaatggattggttaaactactcagc
gaacaagaaaatgcctaa

DBGET integrated database retrieval system