KEGG   Pseudoalteromonas luteoviolacea: S4054249_17225Help
Entry
S4054249_17225    CDS       T04577                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
plz  Pseudoalteromonas luteoviolacea
Brite
KEGG Orthology (KO) [BR:plz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:plz03016]
    S4054249_17225
Enzymes [BR:plz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     S4054249_17225
Transfer RNA biogenesis [BR:plz03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    S4054249_17225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AOT09479
Position
1:complement(4032252..4032986)
Genome map
AA seq 244 aa AA seqDB search
MLEIIYQDDQYVAINKPSGLLVHRSFLDKRETQFAMQMLRDQLGQHVFPVHRLDRPTSGV
LLFALSSEAARDMNQVFIEGTIQKRYLALVRGHSKDEIFVDKPLKEQLDKIADKFADQDK
APQEAQTLVRCLHKASLDIPFGKYPSIRYSLVECFPKTGRKHQIRRHLNHLSTPIIGDVN
HGDNKHNHFFRDHFGLQRLMLFATELKFLHPYTKESILIRAKLGEEMLDICRQLGWPSTE
KDYQ
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaattatttatcaagacgaccagtatgttgctattaataaaccatcaggctta
ctcgttcatcgttcctttttagacaagcgagaaacgcaatttgcgatgcagatgctcaga
gatcaattggggcagcatgtatttcctgtgcatcgtctagacaggccaaccagtggggtc
ttattgtttgctttaagctcagaagcggccagagatatgaatcaagtattcattgaaggc
acaattcaaaagcgctaccttgcgttggtacgtggccacagcaaggacgaaatttttgta
gataagccgcttaaggagcaattggataaaatagcagacaaatttgcagatcaagataaa
gcccctcaagaggcgcagactcttgtgagatgtttgcataaagcaagtttggatattcca
tttggtaaatacccaagtattcgttattcgctggtagagtgctttcctaaaacaggtcga
aaacatcagatccgcagacatctaaatcatttatccacacccataataggtgatgtaaat
catggggataataagcataatcattttttccgtgatcattttggcctacaaaggctgatg
ttatttgcaactgagctaaagtttctccatccttatactaaagaatcaatattaattcgc
gccaagttaggtgaggaaatgttggacatttgccgtcagctaggttggccatcaacggag
aaggattatcagtaa

DBGET integrated database retrieval system