KEGG   Prochlorococcus marinus subsp. marinus CCMP1375: Pro_0840Help
Entry
Pro_0840          CDS       T00137                                 

Gene name
glpX
Definition
(RefSeq) Fructose-1,6-biphosphatase / Sedoheptulose 1,7-biphosphate phosphatase
  KO
K11532  fructose-1,6-bisphosphatase II / sedoheptulose-1,7-bisphosphatase [EC:3.1.3.11 3.1.3.37]
Organism
pma  Prochlorococcus marinus subsp. marinus CCMP1375
Pathway
pma00010  Glycolysis / Gluconeogenesis
pma00030  Pentose phosphate pathway
pma00051  Fructose and mannose metabolism
pma00680  Methane metabolism
pma00710  Carbon fixation in photosynthetic organisms
pma01100  Metabolic pathways
pma01110  Biosynthesis of secondary metabolites
pma01120  Microbial metabolism in diverse environments
pma01130  Biosynthesis of antibiotics
pma01200  Carbon metabolism
Module
pma_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pma_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
pma_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pro_0840 (glpX)
   00030 Pentose phosphate pathway
    Pro_0840 (glpX)
   00051 Fructose and mannose metabolism
    Pro_0840 (glpX)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Pro_0840 (glpX)
   00680 Methane metabolism
    Pro_0840 (glpX)
Enzymes [BR:pma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Pro_0840 (glpX)
    3.1.3.37  sedoheptulose-bisphosphatase
     Pro_0840 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-GeneID: 1462222
NCBI-ProteinID: NP_875232
CYORF: Pro0840
UniProt: Q7TVA4
Position
766305..767309
Genome map
AA seq 334 aa AA seqDB search
MDRTLIQEILEVVEQAAIASAELTGLGQKDEADAAAVEAMRKRMGSIQMQGRIVIGEGER
DEAPMLYIGEEVGSGSGPGVDFAVDPCEGTNLCANNQRGSMAVLAASDRGGLFNAPDFYM
KKLAAPPAAKGKVDIRKSATENINILSSCLGMAVSELTIVVMDRARHKDLIAEIRSTGAR
VQPISDGDVQAAIACGFAGTGTHCLMGIGAAPEGVISAAAMRALGGHFQGQLVYDPAIAM
TKEWADYTKEGNIARLNEMGITDGDKIYEADELASGENVVFAGSGITDGLLFNGVKFEKD
CTRTSSLVISTLDSTARFTNTVHIKDGAKSISLS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtggaccgcactctcattcaagaaattctcgaagttgtcgaacaggcagctatagcctca
gccgagctaacaggtttaggacagaaagacgaagctgatgcagctgccgtagaggctatg
cgtaaaaggatgggatccattcaaatgcagggaaggatagttataggagaaggcgaaaga
gatgaggctcctatgctttatataggtgaagaggttgggagtggttcaggaccaggagtt
gactttgctgtagatccatgtgaaggaaccaatctttgtgctaataatcagcgaggctct
atggctgtattggctgcttctgatcgtggtggtttatttaatgcaccagatttttacatg
aagaaactggcagctcctcctgctgcaaaaggtaaagttgatattaggaaatctgctaca
gaaaatataaatattcttagcagttgtcttggcatggctgtgagtgaactgacaattgta
gttatggatagagctaggcataaagatttaatagcagaaatccgttctactggcgcaaga
gttcaacctatttcagatggtgatgttcaagctgctattgcatgtggctttgcaggcaca
gggactcattgtctaatgggaattggagctgctccagagggggttatttcggcagcagca
atgcgagctctaggaggccattttcaagggcagttggtttacgatcctgcaatagctatg
actaaagagtgggctgattacactaaagaaggaaatattgctcgactcaatgaaatgggg
ataacagatggtgacaagatttatgaagcagatgaattagcttctggagaaaatgttgtt
tttgctggaagtggtattacagatggtttgttatttaatggagttaaatttgaaaaggac
tgtacacgtacaagcagtcttgtaataagcactcttgatagtacagctcgttttacaaat
acagttcatattaaggatggtgcaaagagcatatctttgagctga

DBGET integrated database retrieval system