KEGG   Prochlorococcus marinus subsp. marinus CCMP1375: Pro_1066Help
Entry
Pro_1066          CDS       T00137                                 

Gene name
thrB
Definition
(RefSeq) Homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
pma  Prochlorococcus marinus subsp. marinus CCMP1375
Pathway
pma00260  Glycine, serine and threonine metabolism
pma01100  Metabolic pathways
pma01110  Biosynthesis of secondary metabolites
pma01120  Microbial metabolism in diverse environments
pma01230  Biosynthesis of amino acids
Module
pma_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pro_1066 (thrB)
Enzymes [BR:pma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     Pro_1066 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C DUF3300
Motif
Other DBs
NCBI-GeneID: 1462448
NCBI-ProteinID: NP_875458
CYORF: Pro1066
UniProt: Q7VBM6
Position
984498..985445
Genome map
AA seq 315 aa AA seqDB search
MIQPPIGKKVLVEVPSTTANLGPGFDCLGAALSLTNFFTIKRIDGDSERFELIMESTEGN
HLRGGPENLFYRAAQRVWKAAEVEPFALEARVKLAVPPARGLGSSATAIVAGLVGANALI
NDPLSKEKLLELAIDIEGHPDNVVPSLLGGLCFTAKAASQRWRVVKCDWDDSIKAVVAIP
SLRLSTSEARRVMPKTVPLGDAVMNLGSLTLLLNGLRTGRQDLITDGMHDRLHEPYRWKL
IKGGAQVCEAAINAGAFGCAISGAGPSILALCKEDKGRNISQAMVKAWESEGVASRAPLL
NLQTKGSTWYSNQSK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgattcagccgccaataggtaaaaaagtattagtggaagtgccatccacaacagcgaat
ctaggtccaggatttgactgtttaggagcagctctaagtcttacaaacttttttaccatc
aaaagaattgatggagatagcgagagatttgaattaataatggaaagtactgaaggaaat
catttaagaggaggaccagaaaatctcttttatagagcagctcaaagggtttggaaagca
gctgaagtagagccctttgctctagaagcaagagtaaaattagcagttccacctgcaagg
ggacttggaagtagtgctacagctatcgtcgcaggacttgtaggagcaaatgcactaata
aatgatccattaagcaaagagaagcttcttgaacttgctattgatattgagggtcatcca
gacaatgtagtcccatcacttctaggcggtttatgttttactgcaaaagctgcctctcag
agatggagagttgttaaatgtgattgggacgattctataaaagctgttgttgctattcct
tccttacgtttaagcacgagtgaagcaagaagagtcatgcctaagacagtacctttaggg
gatgctgttatgaacttaggttctttaacactcttgcttaatggtcttagaacaggtcga
caagaccttattactgatggaatgcatgatcgtttgcacgagccttatagatggaaatta
attaaaggaggtgctcaggtttgcgaagcagctattaatgctggagcctttggatgcgcc
attagtggtgcaggtccaagcattctcgccttatgtaaggaagataaaggtagaaatata
agtcaagctatggtgaaagcctgggaaagtgaaggtgttgcaagtcgagctccattactt
aacctacaaaccaaaggctccacttggtattctaatcaaagtaagtag

DBGET integrated database retrieval system