KEGG   Papilio machaon (common yellow swallowtail): 106707989Help
Entry
106707989         CDS       T05138                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00601  Glycosphingolipid biosynthesis - lacto and neolacto series
pmac00603  Glycosphingolipid biosynthesis - globo and isoglobo series
pmac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    106707989
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    106707989
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pmac01003]
    106707989
Enzymes [BR:pmac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     106707989
Glycosyltransferases [BR:pmac01003]
 Glycan extension
  P blood group
   106707989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 106707989
NCBI-ProteinID: XP_014354927
Position
Unknown
AA seq 409 aa AA seqDB search
MVYMLYVGLGGVRYVGAGREGASAEELNALNRQLVDTLRLTDGAFSCGDGDDGMDCIRFG
MVTADTEVDELLELVVAAGKDVEDNSRALTDMTEVLKKDVGTKQKLSFPSSDQFISIKDE
DALPSAESNDFSPSNKSIFFLETSCRSSLNSRDMCAIESAARAHADYQINVLFTAPISEE
ILEEVSLKQKFENVRFARIHIDEYSKNTPVQEIVRSGALDSSQWGVEHTSDLLRYLTLYK
FGGIYLDLDVVVAKRLSTLAANWAARESELTVSNGAMAFSLDSDGRSIAEAAISEIKSSF
RNDLWSYNGPGVITRVLKIRCNTTDLKRMNSDICQGFEVYGPELFYPIKWENGHIYFEPG
ILENKDAYIYHVWNHVTRNRTPNKSSPYAHLARTFCPSTYTLYGDRFGL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggtatacatgttgtacgtaggtctaggcggggtgaggtacgtaggcgcgggtcgtgag
ggcgcgagtgcggaggagctgaatgcactaaaccggcagctggtggacacgctcagactc
accgacggcgccttctcctgcggcgatggtgacgatggcatggactgcatcagattcggt
atggtgactgctgacacggaggttgacgagctgctggagctggtggtggcggctggtaaa
gatgtggaggacaactctcgtgctctcacagacatgactgaagtactcaaaaaggacgtc
ggaacaaagcaaaaactgtcatttccaagcagcgaccagttcatatctataaaggatgag
gatgccttgccatcggctgaaagtaatgatttctcaccgtcgaacaaaagcattttcttc
ctagagacgtcgtgtcgctctagcttgaattcgagagatatgtgtgccatagagtcggcg
gcgagagcgcatgccgactaccaaataaacgtgctgttcactgcaccgatctcagaagag
attctcgaagaagtcagcctcaaacaaaagttcgagaacgttcgatttgcaagaatacat
atagatgaatactctaagaatactccagtgcaagagatcgtccggagcggcgccttggat
agctcacagtggggagtggagcatacatcggacttgttaagatatttaactttgtacaaa
tttggtggtatttatttggatttggatgtggtggttgcgaaacgtttgagcaccttggct
gcgaactgggcggccagagagagcgaattgacagtgagcaacggcgctatggccttttcg
ttggacagcgacggtagaagtattgcggaagctgcgataagcgaaataaagagcagtttc
cgaaacgacttgtggagctacaacgggccaggagtcattactagagtgttaaagataagg
tgcaatactactgacctcaaacgcatgaactctgacatatgtcaaggattcgaagtgtat
ggtccggaacttttttacccgattaaatgggaaaatggccatatttatttcgagccggga
atactcgagaacaaagatgcatacatttatcacgtttggaatcatgtgacaagaaatcgc
acgcccaacaaaagttccccgtacgcacatcttgctcgaacattctgcccgtcgacttac
acattatatggcgatcgatttggattatag

DBGET integrated database retrieval system