KEGG   Papilio machaon (common yellow swallowtail): 106708054Help
Entry
106708054         CDS       T05138                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac03040  Spliceosome
pmac04141  Protein processing in endoplasmic reticulum
pmac04144  Endocytosis
pmac04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106708054
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106708054
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106708054
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    106708054
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmac01009]
    106708054
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pmac03041]
    106708054
   03009 Ribosome biogenesis [BR:pmac03009]
    106708054
   03110 Chaperones and folding catalysts [BR:pmac03110]
    106708054
   04131 Membrane trafficking [BR:pmac04131]
    106708054
   03051 Proteasome [BR:pmac03051]
    106708054
   03029 Mitochondrial biogenesis [BR:pmac03029]
    106708054
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmac04147]
    106708054
Protein phosphatases and associated proteins [BR:pmac01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     106708054
Spliceosome [BR:pmac03041]
 Complex B
  Other components
   Prp19 complex
    106708054
 Complex C
   Prp19-CDC5 complex
    106708054
Ribosome biogenesis [BR:pmac03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    106708054
Chaperones and folding catalysts [BR:pmac03110]
 Heat shock proteins
  HSP70 / DNAK
   106708054
Membrane trafficking [BR:pmac04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    106708054
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    106708054
Proteasome [BR:pmac03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    106708054
Mitochondrial biogenesis [BR:pmac03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    106708054
Exosome [BR:pmac04147]
 Exosomal proteins
  Proteins found in most exosomes
   106708054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70
Motif
Other DBs
NCBI-GeneID: 106708054
NCBI-ProteinID: XP_014355013
Position
Unknown
AA seq 99 aa AA seqDB search
MPAIGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNP
NNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVVNESGKPK
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaattggaatagatctgggaacgacgtattcgtgtgtgggagtttggcagcat
ggcaacgtggaaatcatagccaacgaccaaggcaacagaaccacaccatcttatgtagcg
ttcaccgacacggagcggctgatcggcgatgcggcgaagaaccaggtggccctcaacccc
aacaacacagtgttcgacgccaagcgcctgataggacgcaaattcgacgaccccaagatc
cagcaagacatgaaacattggccgttcaaagtggtaaatgaaagcggaaaacccaaa

DBGET integrated database retrieval system