KEGG   Papilio machaon (common yellow swallowtail): 106708148Help
Entry
106708148         CDS       T05138                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00511  Other glycan degradation
pmac00600  Sphingolipid metabolism
pmac01100  Metabolic pathways
pmac04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106708148
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    106708148
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106708148
Enzymes [BR:pmac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     106708148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 106708148
NCBI-ProteinID: XP_014355111
Position
Unknown
AA seq 125 aa AA seqDB search
MHFVGPMPWDKHKVEVGSWDRAAKYTRSILEDLNNFVVGWIDWNLCLDENGGPNWAHNYV
DAPVLVYGERDEFIKQPMYYALGHFSKFIPRGSQVVEVSRMSSSTVPNIAVVTPEGNLVL
VLHNT
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcgtaggtcctatgccgtgggataagcacaaggtggaggtcgggtcgtgggat
cgcgccgcaaagtacacgcgcagtattctggaggatttaaataacttcgtcgttggctgg
atagattggaacttgtgtttagacgagaacggcggtccgaactgggcccacaactatgtc
gacgcccccgtacttgtttacggcgaaagagatgaatttatcaaacaacctatgtactac
gcattaggacacttctctaagttcatcccgagaggatcccaagtagtagaagtatcgcga
atgagttcctcaacagtaccaaatatcgctgttgtcactcctgagggaaatttggtactt
gttctgcataatacgtaa

DBGET integrated database retrieval system