KEGG   Papilio machaon (common yellow swallowtail): 106708644Help
Entry
106708644         CDS       T05138                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glycine N-methyltransferase
  KO
K00552  glycine N-methyltransferase [EC:2.1.1.20]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00260  Glycine, serine and threonine metabolism
pmac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106708644
Enzymes [BR:pmac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.20  glycine N-methyltransferase
     106708644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_12 Methyltransf_11 Methyltransf_23 DUF3069 CheR
Motif
Other DBs
NCBI-GeneID: 106708644
NCBI-ProteinID: XP_014355667
Position
Unknown
AA seq 341 aa AA seqDB search
MSADKVFHSRSQGIPSEGVKDQYADGKAARVWKKYIGDSNQRTQNYKNFLTGLLRKHNCV
KVLDAACGTGPDIVIIDRSEGCVMLVDVTIPHDENLVKAEKEKLLKYLDLAHEITAMWRM
KSTTIIPIVVSVVSVTLRQMLKHALKARWEKRKDHKYDEWIIEEASWETLPDDMQSFLPG
ATFDAVICLGNSFAHLLDEFEDQRTQKMCLRNFAKVLKPGGLLFIDHRNYDAMINSGATP
GHSIYYNCSYPVDIKTSVLVVRGKPELVALDYLIHTNDDAELNEQSMFRLCYYPHKLDKF
TSMLDEAFDNKAEHSIYADFKALDQVDNPAYYIHVMRKPLN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcggacaaagtattccactcccggtcgcaggggatcccctctgagggtgtgaag
gatcagtacgcggacggcaaggcggccagggtgtggaagaagtacatcggtgacagtaac
cagcgcacgcagaactacaagaacttccttacggggctgctcaggaaacacaactgcgtt
aaggtgctggacgccgcctgcggtacaggacccgatatagtaataatagaccggtctgag
ggttgtgtaatgttagtcgatgtcactattccacatgacgagaatctcgtgaaagctgaa
aaagaaaaattactaaaatacttagacttggctcacgagattaccgccatgtggcgtatg
aaatcgactaccattattccgatagtcgtatcggtggtgtccgtgacgctcagacagatg
ttgaaacatgcgctcaaggcgcgctgggagaagagaaaggaccacaagtatgatgagtgg
ataatcgaagaagcgagttgggagacattgccggacgacatgcagtcgttcctgccgggc
gctaccttcgacgcggtcatctgcctgggcaactcgttcgcccacttgctggacgagttc
gaggaccaacgcacgcagaagatgtgcctccggaacttcgccaaggtgctgaaacctggc
ggcttgctgttcatcgaccacaggaactacgacgccatgatcaacagcggagctacgccc
ggacattccatatattacaattgcagctatccagtggatatcaagacgtcggtcctggtg
gtgcgcgggaagcctgagctggtagcgctggactacctcatccatacgaacgacgacgca
gaactcaacgaacaaagcatgttccggttgtgctactacccacacaagctggacaagttc
acatcgatgctggatgaagcattcgacaacaaggcagagcacagcatatacgctgacttc
aaggcattggatcaagtagacaatcccgcctactacatacatgttatgcggaaaccactc
aattga

DBGET integrated database retrieval system