KEGG   Papilio machaon (common yellow swallowtail): 106708749Help
Entry
106708749         CDS       T05138                                 

Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial isoform X1
  KO
K02890  large subunit ribosomal protein L22
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    106708749
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pmac03011]
    106708749
Ribosome [BR:pmac03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    106708749
  Bacteria
    106708749
  Archaea
    106708749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 106708749
NCBI-ProteinID: XP_014355783
Position
Unknown
AA seq 203 aa AA seqDB search
MNTILKHLCGVGLTSNHVYGIHTSAPIAAWAKAKTPRRFLEYNRKIFPPQAIGEDPRPAF
VCHQKTNFKYSPKKLWYIASFVRGMTVDEAIKQLSFVNKKGAVFVKEAIQEAQELAVKNH
NVEYKSNLWVAESFANKGMLIKGIRRHARGRMGEVRYMYSHYFVRLEEGKPPKDYYKRNE
LTPQEQLDSWLEQMRKRKIVNSY
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaattttgaaacacctttgtggtgtcggattaacatcaaatcatgtttacggc
attcatacaagtgcaccgattgcagcatgggctaaagctaaaactccacgaagatttttg
gaatacaatagaaaaatattccctccgcaggcaatcggcgaggatcccagaccagccttt
gtatgtcaccagaaaactaattttaaatatagtccaaagaagctttggtatattgctagc
tttgttcggggcatgactgttgatgaagctataaaacagcttagttttgtcaacaaaaaa
ggtgctgtatttgttaaggaagcaatacaagaagcccaagaactagcagtgaagaatcat
aatgtagaatataagagtaatttgtgggttgccgaatcctttgcaaataagggcatgttg
ataaagggtataagaagacatgctcgaggcagaatgggagaagttcgttatatgtacagt
cactactttgttcgtcttgaagaaggaaaaccacccaaagattattacaaacgcaatgaa
ttaacaccccaggaacagcttgattcatggttggagcaaatgaggaaacgaaaaattgtt
aattcatactag

DBGET integrated database retrieval system