KEGG   Papilio machaon (common yellow swallowtail): 106710786Help
Entry
106710786         CDS       T05138                                 

Definition
(RefSeq) guanylate cyclase 32E-like
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00230  Purine metabolism
pmac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106710786
Enzymes [BR:pmac01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     106710786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 106710786
NCBI-ProteinID: XP_014358432
Position
Unknown
AA seq 1310 aa AA seqDB search
MWRGARVLVLAALGLLAGPSAAAKKYNITIGYLPSIKGEHRDRQGLAISGALSMALEEIN
NSSVILPDVQLLLEWNDTRCDTVTATRLLTDMSCSGVVAFFGPEGRCHTEAIIAQSRNLP
MISYKCSDYQTSTLPNFARLEPPDTQATKSVLSLLRYYRWNKFSILYEESWVTVALTLEN
HAKQNNMTVNHQRPVIDGFKCCEEKMTCCAPGFWYQFIQETKNKTRIYVFLGSTSGLIEM
MTAMESLQLFAKGEYMVIFVDMMTYSSKDSLKYIINTEDRGSKLVCPNTPEFRKRAQSLL
VVVSSEPTGGYANFTSKVRQYNNMKPFEFPLPTVFGDRFTKFVSIYAAYLYDSVKLYATA
LDKLIKEETDKEQLTYKKLMSIATNGSRIVAEMIKSSPYKSVSGMSIRLDERADSEGNFS
VLAFKPTNFSDNNINCSYSMVPVGNFQQSTRKFPEYKLNPRLPIDWPDSVKPEDEPSCGF
LNEKCPKDESQITSLVVAGTLAVTLFCALVVTISIYRKWKIEQEIEGLLWKIDPHEIAGY
LGSGLVWSPSKLSLASGISCESRCCTQIFTTTAHYRGNVVRIKELKFAKKKDISRDVMKE
MRLLRELRHDNLNSFIGAVVEPLRVLLITDYCAKGSLYDIIENEDIKLDKMFISSLIHDL
IKGMIFIHTSPLIFHGNLKSSNCVVTSRWMLQVTDFGLHELRYCAENEFVGEHQYYRGLL
WKSPELLRQLDDPNGTVGGTQKGDVYAFGIILYEIIARRGPFGLTTLEPKDIVDRVKRVK
GEGEEVFRPDTSALEGVAEEYVVSCMRDCWAEDPALRPDFPTIRSRLKKMKSGKSRNIMD
QMMDMMEKYANNLEELVNERTRLLIEEKQKTEDLLHRMLPKSVARRLTTGEGVEPESFDS
VTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLP
IRNNDRHVGEIASMALELLNAVKTHKIAHRPNETLKLRIGIHTGAVVAGVVGLTMPRYCL
FGDTVNTASRMESNGEPLRIHISPSCKLALDKIGGYLVEPRGTIPIKGKGQLQTYWLVGA
TEKAIQKRPVEGEERPLFRRPRRSPRLTDSRHPSLSELKPRPHRAAPATTASTTRHALSS
IASSTACETDGISETSVGVCGGGGAVSLRGAHSLDLLAPRRDARLRRGHTTRSLDADVAI
STVSGPLFNGTIIGIVTDDPPKTGEDSPLLRKSSLHNKLERPKRKVHDANYIEFYKKWRS
LENMADVKGEARKLPRFAIRSWLLGIFSGTRSSSSSLRRAPPLLDRESAV
NT seq 3933 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcggcgcgcgggtgctggtgctcgcggcgctgggcctactggccgggccttca
gccgccgccaagaagtacaacatcaccatcggctacctgccgtcgatcaaaggcgagcac
agggacaggcagggccttgccatctccggcgccctctccatggccctagaggagatcaac
aacagctcggtcatcctacccgacgtgcagctgctgttggaatggaacgacacgcgctgc
gacacggtgacggcgacgcggctgctcaccgatatgagctgctccggcgttgtggccttc
ttcggccccgagggtcgctgccacacagaggctatcatcgcacagtctcgaaatctacct
atgatctcttataaatgttcagattaccaaacttcaacattgccaaattttgctagactg
gagccgcctgacactcaggcgacgaaatctgtgttatctttattgaggtactacagatgg
aataagttttcgatattatacgaagagtcgtgggtgacggtcgcgctgactctggagaac
cacgcgaagcagaacaacatgacggtgaaccaccagcggcccgtcatcgacggcttcaag
tgctgcgaggagaagatgacctgctgcgcgcccggcttctggtaccagttcatacaggag
accaagaacaagactagaatttacgtgttcttgggctctacgtctggtctcatagaaatg
atgacagccatggagtcgctacagttgttcgctaagggggagtacatggttatatttgtt
gatatgatgacgtactcctcaaaggattctttgaagtatataataaatactgaagatcgt
ggatctaaattggtgtgtccgaacacaccggagtttaggaagcgggcgcagtcactgcta
gttgtggtatcttcagaaccaactggcggttatgcgaacttcacatccaaagttcgacag
tataacaatatgaaaccattcgaatttccattgcctacagtttttggagatagatttacc
aagtttgtgtcaatatatgcggcatatttgtacgattctgtgaaattgtatgccacagct
ttggataaactaataaaagaagagactgacaaggaacaactcacttacaagaaactgatg
agcatcgcaactaatggttctcgaatcgttgctgaaatgataaaatcttcgccgtacaaa
agtgtgtcgggtatgtccattcgactggacgagcgcgcggactcagagggtaacttctcc
gtgcttgccttcaagcccaccaacttcagtgacaacaacatcaactgctcctacagcatg
gtgcctgttggcaacttccagcagtccactcgcaagttccctgaatacaaattaaatccc
cgtttgccgatcgattggccggacagtgtgaagcccgaggacgaaccatcttgcgggttc
ctcaatgaaaagtgtcccaaggatgaatctcagatcacatcgctggtggtggcgggcacg
ctcgctgtcacactgttctgtgctctcgtcgtcaccatcagtatataccgcaaatggaag
atagaacaagagatagaaggattgctttggaagatagatccgcatgaaatagccggatat
ttaggcagcggcctcgtctggtcacctagtaagttgagcctggcgagcggtatatcgtgc
gagagccgatgttgcactcagatcttcacaacgacagcgcactaccgcggcaacgtcgtg
cgcatcaaggagctcaagtttgccaagaagaaagacatatctcgcgacgtgatgaaggag
atgcggctgctgcgcgagctgcgacacgacaacttgaactcgttcatcggcgcggtggtg
gagcctctgcgggtgctcctcatcactgactactgcgccaagggcagcttgtatgacatt
atcgaaaatgaagatattaagttggacaagatgtttatttcttcgctaattcatgatctc
attaagggtatgatatttattcatacatcgccattaatatttcacggcaatctgaaatct
tctaactgtgtagttacatctcgttggatgctgcaggttactgatttcggtctccatgag
ttacgatattgcgccgaaaacgaatttgttggagaacatcaatattacagaggtctgctg
tggaagtctccggagctgctgcgtcagctggatgaccccaacggcacagtgggcggcact
cagaagggcgatgtgtacgccttcggaattatactttacgaaatcatcgctagacgtggc
cctttcggacttactaccttggaacccaaagatatagtagatagagtgaagagagtgaag
ggtgagggcgaggaggtgttccggccggacacgagcgcgctggagggcgtggcggaggag
tacgtggtgtcctgcatgagggactgctgggcggaggaccccgcactgcgaccggacttt
cccaccatacgtagcaggctcaagaagatgaagtccggcaagtcaagaaatataatggac
caaatgatggacatgatggagaagtacgctaataatttagaagaactagtcaacgagagg
acaaggctattgattgaagagaagcagaaaaccgaagatttgttacatagaatgctacca
aagtctgtggcgcggcggctgacgaccggcgagggtgtggagccggagtcatttgactct
gtcacaatatacttcagtgacattgtcggcttcaccgccatgtctgcggagagcacgccg
ctgcaggtcgtcaactttctcaacgacttgtacacggttttcgataggattataagaggc
tacgacgtgtacaaagtagaaactataggagacgcttacatggtggtgtcagggttgccg
atccgcaataacgaccgtcacgtgggtgagatcgcgtcaatggcgcttgagttgctcaac
gcagtcaagacgcacaaaattgcacacagacccaacgaaacactcaaactgagaataggc
attcatacaggtgcggtggtggcgggtgtggtgggtctgacgatgccgcgctactgcctg
ttcggggacaccgtgaacaccgcctcgcgcatggagtccaacggcgagcccttgcgcata
cacatctcgcccagctgcaagctggccctcgacaagatcggcggatatctcgtcgagccc
aggggaactatacccatcaaggggaaaggacagttgcaaacatattggctagtcggtgcg
acagagaaggcgatacaaaagaggcccgtagagggtgaggagcggccgctattccggcga
ccgcgcaggagtccgcgactgaccgactccagacatccttctttatcagaactgaagcct
cgcccgcaccgcgccgcgcccgcaacgaccgcctcgaccacgcgacatgctctgagttcg
atagcgtcgtccacggcgtgcgagactgacggcatctcggagacgtctgtgggcgtgtgc
ggcggcggcggggcggtgtcgctgcgcggcgcgcactcgctggacttgctggcgccgcgt
cgggacgcgcgtctgcgccgcggacacactacgcgctcgctcgacgccgacgtcgccatc
tccacagtgtccggtccgctcttcaacggcaccataatcggtatcgtgaccgacgacccc
ccaaagacgggcgaggacagccccctactgcgcaaaagcagcctacacaacaagctggag
cgacccaaacgtaaagtgcacgacgcaaactacatcgagttctataagaagtggcggtcg
ctggaaaacatggcggatgtgaaaggcgaggcccgcaagctgccgcgcttcgccatccgc
tcctggctgctgggcatcttcagtggcacgcgcagcagcagctcctccttgcgccgcgca
ccgccgctgctcgaccgcgagtccgccgtctag

DBGET integrated database retrieval system