KEGG   Papilio machaon (common yellow swallowtail): 106712737Help
Entry
106712737         CDS       T05138                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pmac  Papilio machaon (common yellow swallowtail)
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmac04131]
    106712737
Membrane trafficking [BR:pmac04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    106712737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 106712737
NCBI-ProteinID: XP_014360861
Position
Unknown
AA seq 1885 aa AA seqDB search
MTLGRKYQNCSGNAGDTRKVYVSQSKSGSLSGCSSSISLCDMIEPPDYEEVCERLMGEKD
PLAYPTNDIELITVPRKIRTLKHVLPDEDLTKAPMFVRDCIRCYTSDYTVVEYKYRMYSG
SAGGRERLNERLERLLNAPPHYYEVDAEPCAALDDLALQQQFESQPSSGRQSVASITSSL
SCNETLTPRGSWASLDLQSSSSDPLIPDLFEKKPPEQMDALNEARRLENRQADLLGLYSP
YLDEEEAVERRLAAEMPCEVMGHRILVVCHQLKLELDVEPLFASMALFDAKEKKKLSENF
YFNLNSESTRQMLSGHVPHADVSTLSRSAVFDIVNPSPDIFLVVRVEKVLQGDVNECVEP
YIKDDKNREKVRSGAQAACNRLGKYRMPLCWSAVSLLNILSGSNSLERDSDKDALPNNNT
TNANTNSLDRKASSSSLEQLRRRAGEVGGSLTRKGSIERRALPAQQADELVAHLDTFKPI
VITVTSFFKQFLAEIKRPSSAPKKLKCIPGTLKIEVSPCPDEIKNGLTPELAKLNPYGDE
EVRPCKEVLPFPPQGAPAPHLQYRNLLYLWVRDLNLAAYTSRTGSARNITILWNPSLYDE
IKLKLPADLGDQHHLLFTFLHVSCQRKPVPPEQEKSVETPVGYSWLPLCRNGKLTCGEFS
LPVMQEEPPPNYSYIFPDVLLPGTRWIDNHKPIFTISLDAHTTVHPLDGYIERFAMACEA
VQEGNIPPRIGLANMEAELRASISELRNANVEVVARYLPVLCDKLLQLLVAPPTLAGHTL
NIAQDVFTCLAQIFTDITNMNEGASCDAHGRSSLITCYVQYQCTIPRPSLTDADIGLPLP
PSVMSDGSCKILHEELALQWVVASGVTRDLAMHNSWSLFELMIKSMVEYLYWSGAHEAPR
KARFPDQFTDDLTTLVNNVTSEIISSYGSNSRLTQSLNNSLAFFLFDLLSVMDRGYVLAL
IRGYHKQMSAKIASLPDAVPLVHYKLAFLRIICSHEHYVSLCLPAGGEGELLEAESTPGG
GGASPRSGSTSQAPPLALSADFRSRHYLAGLLLADLTSALELQSPVLQQAAVNGVLALLT
AHDADPRLQAAALKARVASLYLPLLGIVMDAQPQLHRGFTTGKESLQLDGELSQFGNFYN
TSSPEDFKQNGRPPFNSETSRNLLMCLAWVLKWTSRGVLAACAAELPAPRLHQLLALLDL
CFKCHEYKGRKEILKCAQQNVRKTTDIKAKLEDVILGQGSARNDFIMRRKGGSSGRGCGG
RGGRERWRKEWVRGGARSRPASPARPHPALAAALAAELALALLHALETIVQSVSGLEWGQ
TACSAALGVLLRALQRDQSAPVLQHMFASVRALIVKLGWSCCGEESGICRVLLRHCAALA
AGTRAHASATLYALMRQHYQLGNNFSRVKMQVTMSLSSLVGTSATFSEEALRRALKTVLV
YAERDVELQDTSFPEQVKDLVFNLHMILSDTVKMKEFQQDPEMLLDLMHRIARGYQHSPD
LRLTWLNNMAQKHMERSNHLEAGMCLVHGAALAAEQLNAGGRGAALLQKVTHNALDESCA
DALHHHLTHQELQALLEHAASELMAAGMYEAVNEVYKVLIPIAEEQRDYKKLANIHGKLN
EAFTRIEQLHGKRVFGSYFRVSFYGARFGDLHSEEFIYKEHALTKLPEIFSRLENFYGSR
FGADNVVIIKDSNTVDPATLEPDKAYIQITYVEPYFEPHELRKRITHYERNYNIKRFMYA
TPFTVGGRAHGSLAEQCKRKTILTTAHHFPYVKTRIQRAQKEYIFLFLCFHSFAKFLAPV
AEGRQPPARLTNKLRLAFKDFSKKCHDALRKNKNLIGSDQREYQRELERNFQRFTERLAP
LVRHTPGHVAMLSNGLSKHDYKYQA
NT seq 5658 nt NT seq  +upstreamnt  +downstreamnt
atgacactgggacgcaaatatcagaattgttctgggaatgctggggatactcgtaaggtc
tatgttagccagtcgaagtcgggttctctttcggggtgttcctcttcaatatcactgtgc
gacatgatcgagccaccggactatgaggaggtgtgcgagcggctgatgggggagaaggat
ccgctcgcatacccaaccaacgatatcgaactgatcacggtgccccgcaagatacggact
ttgaagcatgtgctgcctgatgaagacttgacaaaagcgccgatgtttgtgcgcgactgt
ataagatgttatacatcagactacacagttgtggagtacaagtaccgcatgtactctggc
tctgcgggcggccgtgagcggctcaacgagcggctcgagcgcttgctcaacgcaccgccc
cattactatgaagtagacgcggagccctgtgcagcgcttgatgatttagctttgcagcaa
cagtttgaatctcagccatcaagcggtcgtcagtctgtagcttcaataacatcatcattg
tcctgcaatgagacgctgactccgcgtggctcctgggccagcctcgacttacagagctca
tcttccgacccactcataccagatcttttcgaaaagaaacctccggagcaaatggacgca
ctaaatgaagctaggagattggagaaccggcaggcggatctgctggggctgtactccccg
tacctggacgaggaggaggcggtggagcggaggctggcggcggagatgccctgcgaggtg
atgggccacaggatactggttgtctgtcatcagctcaagttggaactagacgtggaacct
ctattcgcttctatggcattatttgacgctaaagaaaagaagaaactgtcagagaatttc
tatttcaacttgaattcagagagcacacgtcagatgttgtctggccacgtgccccacgcg
gatgtctccacgttgagtcgcagcgctgtcttcgatattgtgaacccctcgcctgatata
ttcctggtcgtcagagtagagaaagttctgcagggagatgtcaatgaatgcgttgaacct
tatattaaagatgataagaaccgtgaaaaagttcgtagtggtgcacaggctgcgtgcaat
cgtctcggcaagtaccgcatgccgctgtgctggagcgcggtgtcactgctcaacatcctg
agcggctccaacagcctcgagcgcgactcggacaaggacgccctccccaataacaatacc
acaaatgccaacaccaacagcctcgatcggaaagcatcgtccagcagcttggagcaactg
cgtcgccgagcgggcgaagtgggcggctcgttgacacgcaagggctccattgagaggcgt
gcgctgccagcacagcaagcagacgagctggtcgcacatctcgacaccttcaaacctatc
gtcatcaccgtcaccagcttttttaagcaatttctcgctgaaatcaaaagacccagttca
gcgccgaagaaattgaaatgcattcctggcacattgaagattgaagtgtcgccatgtcct
gatgagatcaagaatggcttaacaccggaattagcaaaattgaatccttatggagatgag
gaggtacgtccgtgtaaggaggtgctgccgttcccgccgcaaggtgcgccggcgcctcat
ctgcagtaccgcaacctgctctacctgtgggtgcgagatctcaacctcgccgcatacacc
tcgcgtacaggatccgccaggaacatcactatactctggaacccatctctatacgatgag
ataaagttgaagcttcctgcggatttgggtgatcagcatcacctgctgttcactttcctg
cacgtctcctgccagaggaagccagtcccacccgagcaggagaagagtgtggagacacct
gtcgggtactcgtggctgccactgtgccgcaatggtaaactgacgtgcggcgagttcagc
ctgccggtgatgcaggaggagcctccgcccaactacagctatatcttccctgacgtgctg
ctgcccggcactcgctggatagacaaccacaagccaatattcaccatatcactggatgcc
cacacaaccgtgcacccattggacggatatatagagaggtttgcgatggcgtgcgaggct
gtgcaggagggcaacattcctccgaggataggactcgccaacatggaggctgaactgcgc
gccagtatatcagagttacgtaacgccaacgtggaggtggtggcgcggtacctgccggtg
ctgtgtgacaagctgctgcagctgctggtcgcaccccccaccctcgccggacacaccctc
aacatcgcacaggacgtcttcacctgcctcgctcagatattcacagatatcacgaatatg
aacgagggtgcgtcgtgtgatgcacatggacgcagcagcctcatcacatgctatgtgcag
taccagtgcaccatcccacgaccctcactcactgatgcagacatcggcctgcctctgcca
ccttctgtgatgagtgatggttcatgtaagatcctgcatgaggagctggcgctgcagtgg
gtggtggccagtggagtcaccagggacctcgctatgcataactcatggtcgttgttcgag
ctgatgataaagtcaatggtggagtacttgtactggagcggagcacatgaggctcctcgt
aaggctcgcttccctgatcagttcactgatgatcttaccaccctcgtcaataatgtcacc
tcagagatcatctcaagttacggaagcaacagccgcctgacgcaaagcctaaataacagt
ctggcgttcttcttgtttgacttgctgagtgttatggatagaggttatgtgctggcgctc
atccgcggctaccacaagcagatgtctgctaagatagcctccctacctgatgctgtaccc
ctcgtgcactacaagttggctttcctccgcatcatctgttcacacgagcactatgtgtct
ctgtgcctgcctgcgggcggggagggggagctgctggaggcggagtccacccccgggggc
ggaggcgcctcccctcgctcgggctccacctcgcaggcgcccccgctggcgctcagcgct
gacttccgctcgaggcactacctcgccggactgttgctggctgatctcacatcagcgttg
gaacttcagagtccagtgctgcagcaggcggcagtgaacggtgtgctggctctgctgacg
gcacacgacgcggaccctcgcctgcaggcggctgcgctgaaggcgcgcgtcgccagcctc
tacctgccgctgctaggtatcgtcatggatgcacagcctcagctacatcgcggcttcacc
acagggaaagaatctctccagttagatggtgaattgagtcagttcggcaatttctacaat
acatcatcacctgaggatttcaaacagaatggtcgtccaccgttcaacagtgagacgagc
cgcaacctgctgatgtgcctggcttgggtgctgaagtggacttctcgtggtgtgctggct
gcctgcgctgctgaacttccagcaccacgtctgcatcagctgctagctctcctcgacctc
tgcttcaaatgtcacgagtacaagggtcgtaaagaaatattgaaatgtgcacaacaaaat
gttcgtaagacaacagatatcaaggcgaagttagaggacgttatacttggacagggctcc
gcgcgtaatgactttatcatgcgacgtaaaggtggatcatcaggtcgcggatgtggtggg
cgtggtggtcgtgagcgttggcgcaaggagtgggtgcggggcggggccaggtccaggccc
gcctccccggcacgcccacaccccgccctcgccgcagcactcgcagctgagctcgccctc
gcactgctgcatgcgctagagactatcgtacagtcagtgagcgggctggagtggggtcag
actgcgtgcagcgcggcgctgggcgtgctgctgcgcgctctgcagcgcgaccagagcgcg
cccgtgctgcagcacatgttcgcctcagtgcgcgcactcatcgtcaagttgggatggtcg
tgctgcggtgaggagtcgggcatctgccgcgtactgctgcggcactgcgccgcgctggct
gccggtactcgcgcgcacgcctccgccacactctacgccctcatgcgccagcactaccag
ctcgggaataacttcagccgtgtaaagatgcaagtgacgatgtcgttgtcctccctggtg
ggtacatccgccacattcagcgaggaggcgctgcgacgtgcgctcaagactgtactcgtg
tatgctgagcgagatgtagagctgcaggacacctccttccccgagcaggtgaaagaccta
gtattcaacctgcacatgatcctgagcgacacagtgaagatgaaggagttccagcaggat
ccggagatgctgttggacctgatgcaccgcatagctcgcggctaccagcacagtcctgat
ttacggctcacttggctcaataatatggcgcagaaacatatggagagatccaatcacctg
gaggcgggcatgtgtctggtgcacggcgcggcgctggcggcggagcagctgaacgcgggc
gggcgaggcgctgctctgctgcagaaagtcacacacaatgccctggatgagagctgtgct
gatgccctgcatcatcatctcacacaccaggagctacaggcattgctggagcatgcagca
agtgagctgatggctgcggggatgtacgaggctgttaatgaggtgtacaaggttctcata
cccattgctgaggagcagcgtgactacaagaagctggctaacatacatgggaaactgaac
gaggcattcacccgcattgagcagttgcacggcaagagagtgttcggttcatacttccgc
gtctccttctatggagctcgctttggtgatcttcactccgaggagttcatatacaaggag
cacgccctcacaaagctgccagagatcttcagcaggttggagaacttctacgggtctcgt
ttcggcgcggacaatgtggtgataataaaggactccaacactgtggaccccgcgacactg
gagcccgacaaggcgtacatacagatcacctacgtggagccctacttcgagcctcacgag
ctgcgcaagcgcatcactcactacgaacgcaattataacatcaagcggttcatgtacgcg
acgccgttcacagtgggaggtcgcgctcacggctctctggcagagcagtgcaagcgcaag
accatactcaccactgcacatcacttcccatatgtaaaaacccgcatacagagggcacag
aaagagtatatttttctcttcctatgcttccactccttcgccaaattcctggcgccggtg
gcagaaggtcgccagcctccagctcgcctcaccaacaagctgcgactcgccttcaaagac
ttctccaaaaaatgtcacgacgcgctgcgcaagaacaagaacctgatcggcagcgaccag
cgcgagtaccagcgcgagttggagcgtaacttccagcgcttcactgagcgcctcgctccc
ctcgtgcgacacacacctggacatgtcgccatgctcagcaacggtctgagcaagcacgac
tacaaatatcaagcttaa

DBGET integrated database retrieval system