KEGG   Papilio machaon (common yellow swallowtail): 106714798Help
Entry
106714798         CDS       T05138                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00010  Glycolysis / Gluconeogenesis
pmac00562  Inositol phosphate metabolism
pmac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106714798
   00562 Inositol phosphate metabolism
    106714798
Enzymes [BR:pmac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     106714798
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     106714798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 106714798
NCBI-ProteinID: XP_014363394
Position
Unknown
AA seq 429 aa AA seqDB search
MKSLLILVTILYTTKTSYSSCYWNENCHYKYFSSKTPYEFVRGDIRDSVVIKPGCKTISL
WGLVRHGKRNPGENFIYKMLDATILKDYIKTSHDKGNGSMCAQDVENLYNWIIDEDTFRN
VHQIAKEGYEEMAGLGHRFSAVFKDLLINADENNYTLRSAYGHWLENSVKGFIKGIGNES
LIVDKSNKSYDIMAPYESCNYYMKGVKQNPDIYREPTKYQDMNEFLSVKDRIQTRTGINY
TLTNENITSLYDLCRYTSSGTHKKFSPWCALFSTEDIKVMEYIGDLRHYYRNSYGTPVNK
IFGRIPLTDLLETFINTKNGKGKQFTIYFTHATMMDMVYTALGLFKDEVPLTAEFRNDAR
KWRSSKSTAFASNLMVTLNRCTDGEETDYNVVFYLNERPLESICNNGECSWREFEEKLKP
FVNTTLDFC
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcattattgatacttgtgacgatactttacacaacgaaaacgtcttattcgtct
tgttattggaatgaaaactgtcattacaaatatttttcaagtaaaacaccatatgagttt
gtgagaggcgatataagagattcagtggtgataaaaccaggatgtaaaacgattagttta
tggggattagtgagacatggaaaaagaaatcctggtgaaaattttatttacaaaatgtta
gatgcaactattttaaaagattacattaaaacgagccatgataaagggaacggtagcatg
tgcgcacaagatgttgaaaatttatacaattggattattgatgaagatacgttccgtaat
gttcaccaaatagctaaagagggttatgaagaaatggctggtctgggacacaggttcagt
gcagtgtttaaagatttgctaattaatgcggatgaaaataattacactttacgctcagct
tatggacattggctagaaaacagtgttaaaggatttatcaaaggcataggaaatgagtca
ctgattgtagataaatcaaataaaagctacgatattatggcgccttatgaatcttgtaac
tattacatgaaaggtgtaaaacaaaatccagacatatacagagaacctacaaagtatcag
gatatgaatgagtttctttcagtaaaggatagaattcaaacgagaactggtatcaactac
acattaactaatgaaaatataacatcattatatgatttatgtcgctacacttcttctggg
acacacaaaaagtttagtccgtggtgtgctctcttcagcacagaagacattaaagtaatg
gaatacattggagacctacgtcattactacagaaatagttacggtacacctgttaacaaa
atatttggtcgtatacctttaactgatttattagaaacatttataaacacaaagaatgga
aaaggaaagcagtttacaatatatttcacgcatgccactatgatggacatggtatacaca
gcactgggcctttttaaagatgaagtgccattaacagcagagtttagaaatgatgcgagg
aaatggagatcatctaaatcaactgccttcgcttcgaacttaatggtgacattgaataga
tgtactgatggcgaggaaacagattacaatgtcgtattttatttgaacgagagaccttta
gagtcaatatgtaacaatggcgaatgttcatggcgagagtttgaagaaaaactaaaacct
ttcgtaaacactacactggacttttgttga

DBGET integrated database retrieval system