KEGG   Papilio machaon (common yellow swallowtail): 106714807Help
Entry
106714807         CDS       T05138                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00071  Fatty acid degradation
pmac01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106714807
Enzymes [BR:pmac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     106714807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf EF-hand_like
Motif
Other DBs
NCBI-GeneID: 106714807
NCBI-ProteinID: XP_014363405
Position
Unknown
AA seq 653 aa AA seqDB search
MLSLNKSRNCDVATFVKFYRTFTTKQRNVRDIDYQYLQRSKVPTMHFQKSLPRLPIPELS
KTSERYLKALKPLLSNDQYTEAERRTQEFILKNGKELQEKLILKDKANKHTSYISEYWFD
LYLRDRVPLPINYNPLIVFQYDSKPGYNDQLVRATNLLISAVRFMNSLRENMLEPEVFHL
QPRKSNTPLFRKVTGFLPEALSWYGAYLFKAFPLDMSQFHGLFGATRIPLFGKDRIYRDP
KSKHILVQRNGHFYVFDVLDGDGNLLLPSELLANLSKILNDNTEKAQHPLGVLTCQNRDE
WAKQRKHLEETGNREMLQKIDSAIFNLILDDVSISDDKHKLLQHFLHADGTNRWFDKSFS
LIVTKDGCSGVNFEHSWGDGVAVLRFFQELYTETTTKPFVHPDSKPVSNNITVTKLDFKL
DDKSINFIENAKKEYKEWCDSLSIDYILYEGLNKEACKKFKVSPDCIMQLGFQAAYHLLH
GNYVGTYESCSTSAFKHGRTETMRPCTEQTKLFCDSLHLNKCSKDELRSMLQECSSYHTQ
LVKEAAMGHGFDRHLFALMKLAEENNLTRPQIYDSYEYKYLNKSILSTSTLSAPSVMAGG
FGPVAREGFGIGYSAFPDKLGAAVTSYKAHNDSSQFIEALHKSFIDITNILSS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgctttcacttaataaatcgagaaactgtgatgtcgctacttttgtaaaattttataga
acttttaccactaaacaaagaaatgttagggatatcgattatcaatatttacaaagaagc
aaagtgcctacaatgcattttcagaagtctttacctcgtttgcccattcctgagttatca
aaaacaagtgagcgatacctcaaagcattaaaaccccttttatccaatgatcaatataca
gaggctgagcgaagaacgcaggagtttatattgaagaatgggaaggaattgcaagaaaaa
ctaatattgaaagataaagccaataagcacacaagttatatctcagagtactggtttgac
ctttatttaagagatcgtgtgcctcttcctattaattacaatccactaatagtgttccag
tatgattccaaaccaggttacaatgaccaattagtacgggcaactaatttgttaattagt
gctgtaaggtttatgaactccttaagagaaaatatgttggaacctgaagtatttcatctt
caaccaagaaaaagtaatacacctttgtttcgaaaagtaacgggcttcctacctgaagct
ttatcatggtatggagcatacttattcaaagcctttccattagatatgagccaatttcat
ggattgtttggagcaactcgcataccattgtttggtaaagacagaatctatagggatcct
aaaagcaaacatattctagttcaaaggaatggacatttctatgtctttgatgtattggat
ggagatggaaatttgttgttaccttctgaactccttgcaaatctatcaaaaatcttgaat
gataatacagagaaagctcaacatcctttgggagtcctaacatgtcaaaatcgtgatgaa
tgggccaaacagaggaaacatttagaagagaccggcaacagggagatgttgcaaaaaata
gactctgctatttttaatctcatattagatgatgtaagcataagtgatgataagcataag
ttattgcaacatttcttgcatgcagatggcacaaacagatggtttgacaaatcctttagt
cttattgtgactaaagatggatgttctggagtcaatttcgaacattcgtggggcgatggt
gttgcagtgctaagattcttccaagaactttacacggaaactacaaccaagcctttcgtt
catcctgatagcaaaccagttagtaataacattactgtaaccaagttagacttcaaactc
gacgataaatccataaatttcatagaaaacgcaaaaaaagaatataaagagtggtgtgac
tcactgagtatagactatatactctatgaaggtctgaataaagaagcatgtaaaaagttt
aaagtcagccctgattgtataatgcaactcggttttcaggcagcttatcatcttctgcac
gggaattatgtgggtacatacgaatcctgcagcacgtcagctttcaaacatggcagaact
gaaactatgcgaccttgcaccgaacaaactaaattattctgcgattcactacacttgaat
aagtgttcaaaggatgaattacgttcaatgttgcaagaatgttcatcatatcatactcaa
ctggtgaaggaagccgcaatggggcacggttttgatcgccatctcttcgctcttatgaaa
ttagcagaagaaaataacttaacaagaccgcagatatacgattcctatgaatacaagtat
cttaataaatcaattctaagtacaagcactttgtcagctcctagtgtaatggccggtggt
tttggacccgtcgctagagaaggttttggaattggatattcagcattcccggataagctg
ggagcagctgtgacaagctacaaggctcacaatgatagctctcagttcattgaagctctg
cataaatcatttatagatataaccaacatactttctagctaa

DBGET integrated database retrieval system