KEGG   Papilio machaon (common yellow swallowtail): 106715395Help
Entry
106715395         CDS       T05138                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase-like
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmac01009]
    106715395
Enzymes [BR:pmac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     106715395
Protein phosphatases and associated proteins [BR:pmac01009]
 HAD phosphatases
  Other HAD phosphatases
   106715395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-GeneID: 106715395
NCBI-ProteinID: XP_014364167
Position
Unknown
AA seq 152 aa AA seqDB search
MIFKNVTHVLFDLDGLLIDSERLYTEAFSNICAKYDKEFTWELKRSILGFQGHECAERII
KTLDLPLTGESFMEECKKEYEKVFVNVQLMPVFQCLVFEDAVNGVKAALAANMQVVVVPD
PRIDTEDLKHATLCLKSLEDFQPELFGLPPFD
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgattttcaaaaatgtaacccatgtcctatttgatttagatggcttacttatcgattct
gaacgattatacactgaagcattctctaatatttgtgctaagtatgataaggagtttact
tgggaattaaagaggagcattttgggttttcaaggccatgaatgtgcagagagaataata
aaaacactagatctaccactaacaggggaatcttttatggaagagtgtaaaaaagaatat
gagaaagtttttgtgaatgttcaacttatgcctgtgtttcagtgcttagtgtttgaggat
gcagtgaatggagtgaaagcagcattggctgctaacatgcaggttgtagttgtgcccgat
cctcgcatagacacagaagacctaaaacatgctacattgtgtttgaaatcattggaagat
tttcaaccagaactatttggattgcctccatttgattag

DBGET integrated database retrieval system