KEGG   Papilio machaon (common yellow swallowtail): 106715859Help
Entry
106715859         CDS       T05138                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00450  Selenocompound metabolism
pmac00970  Aminoacyl-tRNA biosynthesis
pmac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    106715859
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106715859
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmac01007]
    106715859
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmac03016]
    106715859
Enzymes [BR:pmac01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     106715859
Amino acid related enzymes [BR:pmac01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   106715859
Transfer RNA biogenesis [BR:pmac03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    106715859
 Prokaryotic type
   Other AARSs
    106715859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 106715859
NCBI-ProteinID: XP_014364705
Position
Unknown
AA seq 312 aa AA seqDB search
MRLTIRLLSSVARKRPFYVTTPIFYVNAAPHLGHLYSALVADAVQRFEKLTNPDCNIIFS
TGTDEHGTKIQQAAAKANLSLSTYCDKISQEYRDLFRDFNINHTDFIRTTEDRHKKAVAH
FWKELVKRDYIYKAKYSGWYSVNDEAFIPETHLRDDIVDGEKLKVSIESGHSVEWTEETN
YMFRLSAFKTHLQDWLKTDGVVTPSRFQKQLLDYLDNETYFPDISVSRPSSRVHWAIRVP
GDDYFSETKLINIANAELADTLGNLAARCAAPALNISNTQHHISAETLATCRGEDTTGKL
MDAVERLPVIQF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagactgacaatacgattgttatcttctgtggcgcggaaaagaccattttatgttact
acaccgattttttacgtaaatgccgcaccacatcttgggcacttatattcagcattggta
gcagatgcagtgcagagatttgaaaaactcacaaaccctgactgtaacataatatttagc
acaggcacagatgaacatggtacaaagatccaacaagcagccgccaaagccaacctatcc
ctgtcaacatactgtgacaaaatatctcaagagtacagagatctgttcagagacttcaac
attaaccatacagacttcatacgtactacagaagataggcataagaaagcggttgcacat
ttttggaaagaactagtgaaacgagattacatctacaaagcgaagtattccggttggtac
agtgtcaatgatgaggcatttatacctgagacacatttgagagatgatattgtggatgga
gaaaaattgaaagtatcaatagaatctggtcacagtgtggaatggacagaggagacaaac
tatatgttcagattgagcgcattcaaaacacatctgcaagattggctcaaaacagatggt
gtggtaactcccagtaggtttcagaagcaactcttggactatttggataacgagacttat
ttcccagacatttcagtcagcagaccttcctccagagtacattgggctatcagggtgcca
ggtgatgattatttcagtgagactaagttaataaatatcgcaaatgctgaacttgctgac
acactcggcaacttggcggctcgttgtgctgcgcctgcgctgaacatctctaacacacag
catcacatctctgcggagacactcgctacttgcaggggagaggacaccacagggaaactt
atggacgcagtggagagactgccagtaatacaattttaa

DBGET integrated database retrieval system