KEGG   Papilio machaon (common yellow swallowtail): 106716923Help
Entry
106716923         CDS       T05138                                 

Definition
(RefSeq) probable peroxisomal acyl-coenzyme A oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00071  Fatty acid degradation
pmac00592  alpha-Linolenic acid metabolism
pmac01040  Biosynthesis of unsaturated fatty acids
pmac01100  Metabolic pathways
pmac01212  Fatty acid metabolism
pmac04146  Peroxisome
Module
pmac_M00087  beta-Oxidation
pmac_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106716923
   00592 alpha-Linolenic acid metabolism
    106716923
   01040 Biosynthesis of unsaturated fatty acids
    106716923
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106716923
Enzymes [BR:pmac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     106716923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 106716923
NCBI-ProteinID: XP_014366075
Position
Unknown
AA seq 681 aa AA seqDB search
MLHSILTWFLNTYNINMSEVNINEDLVKERKKCTFDVEELIHLVDGGKHNTLERKKVEQY
VLSIKELKDDVPEEYLSHKERYENSVRKGSILFMVLMKGILERKRNKDEGISYNYKIING
VVKDVTPFMLHFGMFLPTLASQASPEQQREWLKKGSQMIGTYAQTELGHGTFLRGLETTA
TYDADTEEFIIHSPNLTSYKWWPGGLAQTVNHCIVMAQLYIKGKNHGIHPFLVQIRDIET
HMPLPGIKVGDIGPKLGFQTANNGFLGFDNYRIPRMNMLMKNSQVLKDGTYVKAKNDKLT
YGTMVFVRVTIVADVAYELARAATIAVRYAAVRHQSKPKPNEPEPQILDYVTQQHKLFIA
VSTSHAFRIVGRWLWSTYTKVVADIRHGNMDHLPELHALACCLKAVCSKDASVCVEQCRF
ACGGHGYMQSSNLPIIYGIVTATVTYEGEHTVMLLQTARYLVKAYKQASEGKSLTPTVAY
MAKYLKNGSHCWQNTPEGIIGGFQAVAAGKTKEACESLFRHVKSGKDYVSCHSFLLIQYF
ISQAHARAVLCEMFWKEIQRISSTVSPSLAIVLEQLAELYLKYWALEKRGDMLMYSNITK
EDISSLQRRYVELLALIRPNAVGIVDAFDIRDEILCSTLGAYDGRVYERLMEEAMKSPLN
KEPVNQSFHKYIKPLLIQAKL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgttgcattcaattttaacttggtttttaaatacttataatattaacatgagtgaagtt
aatataaacgaagatttggtcaaagagagaaagaagtgcactttcgatgtcgaagagtta
attcatttagtggacggtgggaaacacaacacattggagaggaaaaaagttgagcaatat
gtgctaagtataaaggaactgaaagacgatgttcccgaggagtacttgagtcacaaggaa
cgctacgagaactcggtgcgcaaggggagcattcttttcatggtgcttatgaaaggaata
ctagagcggaaacgaaataaagatgagggaatttcatataactacaaaattataaatgga
gtggtaaaggacgtaacaccatttatgcttcactttggtatgttcctgccgacgctcgct
tcgcaagcgtcgccggagcagcagcgggaatggctcaagaaaggtagtcaaatgatcggt
acttatgctcagactgaacttggtcatggaacatttctaagaggcttggagacaaccgct
acatatgacgctgacactgaagaatttatcatacacagtccaaatttgacttcttacaaa
tggtggcccggaggattggcgcaaactgtcaaccactgcatcgtaatggcccagttatac
ataaagggaaagaaccatggtattcatccctttttggtacaaatacgagacatagaaact
catatgccgttacctgggatcaaagtaggcgatattggaccaaaacttggattccaaact
gccaacaatggtttccttggattcgacaattatcgaattccaagaatgaatatgcttatg
aagaattctcaagtgttaaaggacggtacatacgttaaagcaaagaacgacaaactgacg
tacggcacaatggttttcgtacgagtcacgatagtagcggacgtggcgtatgagctggcg
cgcgccgccaccatcgccgtgcgctatgcagcagtcaggcaccaatccaaaccgaagccg
aatgagccggagcctcaaatcttggactacgtgacgcagcagcacaagttgttcattgcg
gtgtcaacgagccacgcattccgcattgtgggccgctggctttggagcacatataccaag
gtcgtcgcagacattcgtcacggcaatatggaccacctaccagagctccatgccctggcg
tgctgcctgaaggcagtgtgcagtaaagatgcctcagtttgcgtggagcagtgtcgtttc
gcgtgcggcggccacggctacatgcagtcctccaacttgcccatcatatacggcattgtc
acggcaactgtcacttacgaaggagagcacactgtgatgttgttgcagactgccagatat
ctcgtaaaagcatacaagcaagccagtgagggtaaaagtttaacgccgactgtcgcttac
atggccaagtatttgaagaatggcagtcattgctggcagaacacgcccgaaggtatcatt
ggaggctttcaagctgtcgctgctgggaaaacaaaggaagcgtgtgaatcattgttccga
catgttaagtccgggaaggattacgtctcgtgtcacagttttctattaatacaatatttt
atatcgcaggcgcacgctcgcgctgttctatgcgagatgttctggaaggagattcaaaga
atatcatccaccgtatctccaagtttggcgatagttttggaacaattagcggaactgtac
cttaagtattgggctctagagaaacgcggcgatatgttaatgtattcgaatataactaaa
gaagacatcagcagcttgcagagaagatatgtagaattgttggcactcattcggccgaat
gctgtgggaattgtggacgcgtttgatatcagagatgagattttgtgttctacccttggt
gcttatgacggtcgtgtctacgagagactgatggaggaggcgatgaagagtccacttaat
aaggaacctgtcaaccagagcttccacaagtacatcaagccgctactgatacaagccaag
ctataa

DBGET integrated database retrieval system