KEGG   Papilio machaon (common yellow swallowtail): 106717246Help
Entry
106717246         CDS       T05138                                 

Definition
(RefSeq) muscle M-line assembly protein unc-89
  KO
K12567  titin [EC:2.7.11.1]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmac01001]
    106717246
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmac04131]
    106717246
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pmac04812]
    106717246
   04147 Exosome [BR:pmac04147]
    106717246
Enzymes [BR:pmac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106717246
Protein kinases [BR:pmac01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106717246
Membrane trafficking [BR:pmac04131]
 Others
  Actin-binding proteins
   Others
    106717246
Cytoskeleton proteins [BR:pmac04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     106717246
Exosome [BR:pmac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106717246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set
Motif
Other DBs
NCBI-GeneID: 106717246
NCBI-ProteinID: XP_014366496
UniProt: A0A194QV45
Position
Unknown
AA seq 1055 aa AA seqDB search
MGNQHSASHASHRPRKNVHWKSAGRPAPPGKPHITPILTDDEPNAITLRWAAPAHDGGAP
LQGYQVECNRLGAPDWIRTAPPVVARPELVLTGLGPPHRYQFRVAALNIVGRSDYSEISD
ILTVSSERGLQEAPVFHQHLEDVTVLENEKTEFRVVFTGTPAPTIGWFKDDYEIFSSRRT
AITTNESSSVLIFHQTLASDEGEIKCTATNRIGHAVSKARLVLEAAPKLRYPRQYEDGLL
YEINETVFLKTTIVGKPTPSVEWRHDGQPIEVDDRVEITTTPKFSLLKIHSARRSDRGEY
QIQARNNIGEDTASFLVTITAPPDPPRRVTVTRQVDKSVTLDWEPPEDDGGCRIGNYVVE
YYRNGWNVWLKATTSRKTNVTLFDLIEGSEYRFRVKAESPYGMSLPSVESPPVRIPGRAV
DMEFLAVESRIINQVLTREEGEEPPVSPVPRRKRVNAASPAVNDTSPPRKQKQTSPRTQP
EGSNEFMLVLYPESNKSAEKAEKRKSFQLDLEDALSPPPISLSAPELSTRNILPFKALRN
AVSSTELLHERAMARFYKAIAMKEEQTKRHDEPHKHDSIDNDIPYKPDANQQETSDNTHI
SKSPVPPVTGTFKKPEIFIKTDSIENKQYKYTPELVPQDSEISENKWQQMSFDEDYTAST
VSTDGEYSDEDSLSEEIDRLQYNVEEETYNPRNKITRPSPVKELSEEKELENELENELEE
ERPKLSPLPDPNFIPKPILKRREADNLNNLHVNKSERGENQIENNRKKEKITLLKRITKI
PVQKPFNLPKILNKKEKEKTPKSNTQNIDSKIEDTIENINDKVVEESKTVIDYYGNIVKE
YGSHKKSTTPLYLSTDDLKTVAEKQQLVSNVEEEKESPIISEQKNMKSESRQKPLSKESL
ESKPRGKVTPVVAKTIKTVNKNAATQPESIQKVSPKVEKNIPSKEQAKSNIKPPTKPSQN
TQIVLKKTERATIIIPIDYQKLEERAKRNVRTAIDYTVDVCLLLLAFWVYFFRDERLAIP
ILILIIYRQLQETFLLDIPEWLRTHAPEWLKKKTS
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccaacactctgcctcacacgcctcccacagacctaggaaaaacgtgcattgg
aagtccgcagggcgacctgcaccgcccggcaaaccacacataacgccaattctaaccgat
gacgagccgaacgcgatcacgttgcgatgggcggcgcccgcgcacgacggtggcgcgcct
ctgcagggctaccaggtagagtgcaacaggctgggagcgcctgattggatccgcactgcg
ccgcctgtggtagcccgccccgaactggtgctcaccgggctcggacccccgcaccgctac
caattccgtgtcgccgcgctcaacatagtcggaagatcggactacagcgaaatatctgac
atactcactgtgagctctgagcgaggcctacaggaagcacctgtatttcatcagcactta
gaagacgtaacggttctagaaaacgaaaaaaccgagtttcgcgttgtcttcaccggcaca
cccgctccgacgattggttggtttaaagacgactacgaaatttttagtagtagaagaact
gcgataaccacgaacgaatcctccagcgtcctaatatttcatcagactcttgccagtgat
gaaggtgagataaaatgcaccgcaacgaaccgcatcggccatgcagtatcgaaagctcgg
ctagtactcgaagctgcacctaagttacgttacccgcgccaatacgaagatggcctgttg
tacgaaatcaatgaaacggtgtttcttaaaaccacaatcgtgggtaagccaactccaagt
gtggaatggcgtcatgatggccaaccaatcgaggtcgatgatcgcgtcgaaattacaact
actccaaaattttctttgctgaagatacactctgcccgtagaagtgatagaggggaatat
caaatacaagctcgtaacaacataggagaagacacggcgtcatttctagtcaccatcact
gcgcctccggacccacctcgtcgcgtaaccgtcacacgtcaggtcgacaagtcggtgacg
ctggactgggagccccccgaggatgacggcggatgtcgaataggtaactacgttgtggaa
tactaccgcaatggatggaacgtgtggttaaaggcgacgacgagtcgtaaaacaaatgtc
acgctcttcgatttaatagaagggagcgagtaccgatttcgtgtgaaagcggaaagccct
tacggtatgagtttaccgagcgtagaatcgccgccggtccgtattccgggtcgggcggtg
gatatggaatttcttgcggtggagtcgcgcattatcaatcaggttttaactcgagaagaa
ggcgaggagccaccagtgtcgccggtgccgcgtcgtaagcgcgtcaacgccgcttcgccc
gctgtcaacgacacgtctccgccgcgtaagcagaagcagacttctcctagaacgcaacct
gaaggaagcaacgagtttatgcttgtattgtatcctgaaagtaacaaatcagcggaaaaa
gcagaaaagagaaaatcgtttcaactcgacttggaagacgcactttcgccaccgccaatt
tcgctttctgctcccgagttaagtacgcgaaacatcttgccatttaaagcacttcgcaat
gcagttagctccaccgaactattacacgagagggcaatggcacgcttctacaaagctata
gctatgaaggaagagcaaacgaagcgacacgacgaaccccacaaacacgacagcatagac
aatgacattccttacaaaccagatgcaaatcaacaagagacttcggataatacacatata
tccaaatcaccggtacctccagtcacaggaacttttaagaaacctgaaattttcattaaa
acggattctattgaaaataaacaatacaaatatactccagaactagtgccccaagattct
gaaatatcagaaaataaatggcaacaaatgtcatttgacgaagattatacagctagtact
gtctcgacagatggagagtattcagacgaagatagcctcagtgaagagatagataggttg
caatataacgtagaagaggaaacatacaacccaagaaataaaataacccgcccttcacct
gttaaagaactatctgaagaaaaggaattagaaaatgagctggaaaatgaactggaagaa
gaaagacctaaattgtcacctcttcccgatccgaattttattccaaagcctatacttaaa
cgaagagaagctgataatttaaataatttacacgttaataaatctgagcgtggagaaaat
caaattgaaaataacaggaaaaaagaaaaaattacactattaaaaagaataacaaaaatt
cctgttcaaaagccgttcaatttaccgaaaattctaaacaaaaaagaaaaagagaaaacg
cctaaatccaatactcaaaacattgacagtaaaattgaagacactatagaaaatattaac
gacaaagttgttgaggaaagcaaaactgttatagactattatggtaatattgtaaaagaa
tacggtagtcataaaaagtcaacgacaccactttatcttagtacagatgacctgaaaacc
gtagcagaaaaacaacagttagtcagtaatgtagaagaagaaaaagaaagtcccattatt
tctgaacagaaaaatatgaaatctgagagtagacaaaaacctttatcaaaggaatctctc
gaaagtaagcctaggggtaaagttacacctgtagttgcaaaaactataaaaacagttaat
aagaacgccgctacacaaccggaatctattcagaaagtgtcaccaaaggtagaaaaaaat
attccatctaaagaacaggcaaagtctaatataaaacctccaaccaaacctagtcaaaat
acacaaatagtcttaaagaaaactgaaagagctacaattattataccaatagattatcaa
aaacttgaagagcgagctaaaaggaatgttagaacagctatagattacacggtcgatgtt
tgtttattgttgttagctttttgggtttattttttcagggatgaaagacttgcaatacca
attcttattttaattatttaccgacagctgcaagaaacttttctcctggatattcctgaa
tggttaagaacacacgctcctgagtggctcaagaaaaaaacttcttga

DBGET integrated database retrieval system