KEGG   Papilio machaon (common yellow swallowtail): 106719616Help
Entry
106719616         CDS       T05138                                 

Definition
(RefSeq) probable maleylacetoacetate isomerase 1 isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00350  Tyrosine metabolism
pmac01100  Metabolic pathways
Module
pmac_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106719616
Enzymes [BR:pmac01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     106719616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C Glutaredoxin Type2_restr_D3 GST_N_4 Tom37 GST_C_2 DNA_pol_lambd_f
Motif
Other DBs
NCBI-GeneID: 106719616
NCBI-ProteinID: XP_014369477
Position
Unknown
AA seq 216 aa AA seqDB search
MVAERAVLYAYWLSSCSWRVRAALHLKRIPYDEKTVDIVREQSHLTDQYRAINPSQKVPA
LVIDGATIVESMAILQYLEDTRPDPTLTPKTPLLRARMTEICETIVSGIQPLQNIGLRSH
FDSKEKFQSFAKYWTERGLRTVEDQLQSTAGKYCVRDQLTMADLCLVPQVYNGVNRYAIE
LNKYPILHKIYKSLLEEDIFKKTHPEVVKSEIVIEK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggtggctgaacgagccgtattgtacgcgtactggctatcctcatgttcgtggcgagtt
cgcgctgcactacacctcaagcgtataccatacgacgagaagactgtagacatcgtgcga
gagcagagtcatctcacggaccagtatcgcgccatcaacccctcgcagaaggttcccgct
cttgttattgatggagcaactattgtggagtcaatggcaattcttcaatatttggaagat
acgcgaccggatccaacactgactcctaaaactcctttactaagagctaggatgacggaa
atatgcgagactatagtatcggggatccaaccgctacaaaacataggactaagaagtcac
ttcgatagcaaggagaagttccagtccttcgcgaagtactggacggagcgaggtcttagg
acagtcgaggatcaactacaatcgaccgctggcaagtactgtgttagagaccaactgact
atggccgacctgtgtctagtgccgcaagtctataatggtgtgaacaggtacgctatagaa
ttgaacaaatacccgatacttcacaaaatctacaaaagtctgttagaggaagatattttc
aagaaaactcatccagaggttgtgaaatctgaaatagtaatagaaaaataa

DBGET integrated database retrieval system