KEGG   Papilio machaon (common yellow swallowtail): 106721157Help
Entry
106721157         CDS       T05138                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 1-like isoform X1
Organism
pmac  Papilio machaon (common yellow swallowtail)
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Peripla_BP_6 HNOBA
Motif
Other DBs
NCBI-GeneID: 106721157
NCBI-ProteinID: XP_014371531
Position
Unknown
AA seq 1455 aa AA seqDB search
MLKKVVEAIFLKNTCRIFRTRKLARKVYASRSNFKRRRNDEDSIKKDVNSETKHSQYLDN
TQAHEVKNQKNNFIKSVKIPRLLFLAIFYVCLFNVLTMCDVNVNTVNIKENTDIYKSPVS
NTFNKEKSKINLGQSTSKVHEKNLRKGRASLQEESVEEKSEKYANSDAQDLDKYYNYYKN
KEEFINTTEYPKNFLLLNNIYDNVRAIGYPHDLASSPYFVKRTNFNLRPERHQFDEKIVK
FGVLLSADPTQVFSLAKVLPIVEMAAVAVTTEDGPLPGWKILVDYRDTRCSSVDGPLAAF
EFYVNGSADAFIGPGCEYVIAPVARYAGPWRIPVLTAGGQAEAFGYKQPSYQTLTRMMGS
YTQAGVAIRKVFEEFNWRKLGMLYHNNDPASGKGNSPCYLTLSAVFSVLLKKNSGSSIPN
IPFDETVTNTTVIKELLTNLSLMTRIVVVCANPSTVREIMLAADELNMVSSGEYVFFNIE
LFSNLASASSKEPWKIEGDTEERNERARRAYSAVLTVTSPAPEKKEYLEFSDKVKDLAAT
KYNYTFGKGEMVSTFVAAFYDAVLLYALALNDTLSQSADPRGQLDGSAVIRNMWNRTFQG
ITGEVIIDANGDRVASYSLLDMNPNTSKFEVVATYIAANSSLQFIANRPIHWAGGRTTPP
PDTPECGFDGSLCPDNSLPVYAILSIVLSSVVVILAILSVFIYRHYKLEAEIAMMTWRVS
WSDVLLPGGKLRGSMHSLARRYSSGTAYSDEATSLAGDRQVYAPCGFYKGCRVAIKNVDK
QRIDLTRPLLLELKKMKDLEHDHLARFYGACVDPPHCCLLTEYCPKGSLQDILENDTIKL
DWMFKVSLMHDIVRGMHYLHGTDIRSHGALKSSNCVVDSRFVLKITDFGLHALRTAEKDF
KAHSYWTRLLWTAPELLRMSEPPPEGTQKGDVYSFGIIMHEIVNRQGAFWLGPGIDMAPK
EIIETVVASGIRPNTTHHRSFEADEATELMRRCWAEDPTERPDFGHLKGAIRRLNKSQES
SNILDNLLSRMEQYANNLEALVSERTQDYLEEKKKCEELLYQLLPKSVASQLINGQSVVA
ETFESVTIYFSDIVGFTALSASSTPMQVVDLLNDLYTCFDSIVENYDVYKVETIGDAYMV
VSGLPERNGTRHAREVARMALALLDAVRRFRIRHRPHDQLKLRIGLHSGPCVAGVVGLKM
PRYCLFGDTVNTASRMESNGEALKIHVSPTTKALLDSFGTFRLECRGEVAMKGKGVLVTY
WLLGEIIDPNAPKEKPHIAKLQLQSNVSGSLSHLTPFKQRLDHGSRSSSRRGSGIFQQQK
ANDVHKLEKEIQPFLQVIKMQRQLSEPTEAVTNGVEDHSTETDKLNPPNSIALNVSTLNH
NSVNQSGQPKVKLKECQINSIGNHKSNKIGNNNWLPKISTASSFDSASKKSTECLKDYSG
VPLLSKAETPNDSIV
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagaaggtcgtggaagcgatatttcttaaaaatacttgtagaatattcagaaca
aggaagttagcaaggaaggtatacgcaagtcgttccaatttcaaaagaagacgaaatgat
gaagattcaattaaaaaagatgttaatagtgagacaaagcacagtcaatatttggacaat
actcaagcacacgaggttaaaaaccaaaagaataattttataaagagtgtgaaaataccc
aggttgctattcctcgcaattttttacgtatgtctttttaatgttctaactatgtgtgat
gttaatgtaaatactgtaaatataaaagaaaacacagatatttataagtcgcctgtgagc
aatacatttaacaaagaaaaatctaaaataaatctcggccaatcgacgtcaaaagtccat
gaaaagaatttaagaaagggccgtgcttctttgcaagaagaatcagtagaagagaaatct
gaaaagtatgccaatagtgatgcacaagatctcgataaatattacaattattacaaaaat
aaggaagagtttataaataccacagaatatcctaaaaatttcttattattaaacaatatt
tatgacaacgttcgtgctattggttatcctcatgacttagcaagtagtccgtattttgta
aagaggacaaattttaatttaagacccgaaaggcatcaattcgatgaaaagatagtgaaa
ttcggagtactgttatcagcagaccctactcaagtattctcactagctaaagttcttcca
atagtagaaatggcggcagtggcagtaacaacagaggatggaccattaccaggatggaaa
attttagtagattatagagatacaagatgttcttctgttgatggacctttggcagctttt
gagttttacgttaatggttctgctgatgcatttattggaccagggtgtgaatatgtgata
gccccagtcgctagatacgctggtccgtggcggattccagtcctaactgcaggcggacag
gccgaagcatttggatacaaacaaccgagctaccaaaccctcacaagaatgatgggcagc
tatacacaagcgggagtagcaattagaaaagtttttgaggaatttaattggcgtaagctg
ggcatgctctatcacaacaatgaccctgcatcaggaaaggggaacagtccatgctatctg
actcttagcgccgtgttctccgtcctgttaaagaagaattccggatcatccataccaaac
ataccgttcgatgaaacggtgacaaatacgacagtcataaaggaattgcttacgaatctc
tcgttaatgacgagaattgttgtggtctgcgcaaacccgagcacagtgagagagataatg
ctagccgccgatgaactgaacatggtgtcatcaggagaatacgtattcttcaacatagaa
cttttttccaacttagcatccgcatcatcaaaagaaccatggaagatagaaggcgacaca
gaagaaaggaacgagcgagctcgacgggcatacagtgctgtgttgacagtcaccagcccc
gcgccagagaaaaaagaatacctcgagttctctgataaggtaaaggatctagcggctaca
aaatataactacacatttggcaagggggagatggtgtcgacattcgttgcagctttctac
gacgccgtgttgctctacgctcttgctctcaacgatactttgagccagtccgccgacccg
aggggtcagctagatgggtctgctgttattcgcaacatgtggaatagaacctttcaaggt
ataactggggaggttataattgatgcaaatggcgatcgtgtggcttcatactcactattg
gacatgaacccaaacaccagtaagtttgaggtcgtcgcaacttacatagcggcaaattcg
tctctacaattcatcgcaaaccgtccgattcactgggccggggggcgcaccaccccaccg
ccagacactcccgagtgtggttttgacggctccctttgccccgacaactctctaccggta
tacgcaattttgagtatagtactcagttctgttgtggtgatcttagcaattttatcagta
tttatttatagacattacaagctggaagcggagatagcgatgatgacgtggcgggtgagc
tggagcgacgtgctgctgccgggcggcaagctacgcggcagcatgcattcgctcgcacga
agatacagctcggggacggcgtattccgatgaggctacgtcactggccggtgatagacaa
gtttacgccccttgcggcttctataaagggtgcagggtcgcaataaagaacgtcgataaa
caacgaatcgatctcacaagaccattattacttgaactcaaaaagatgaaagatctggaa
cacgaccacttagcgaggttctacggcgcctgcgtggatccaccacattgttgcctgctc
accgagtactgtccgaagggatcgttgcaggatattttggaaaacgacacaataaaactt
gattggatgttcaaagtcagcttaatgcacgatattgttcggggaatgcactatctccat
ggcactgatataagatctcacggcgctttgaaatcgagcaattgcgttgttgactctaga
ttcgttttgaaaataactgatttcggtctacacgctctgaggaccgccgagaaagatttt
aaggcacacagttattggacccgtttactatggaccgctccggaattgttgaggatgtcg
gaacctcctccagaggggacgcaaaaaggcgacgtgtattcctttggcattattatgcat
gagatagttaacagacagggggcgttctggctaggaccgggcattgacatggcccctaaa
gagatcatagaaactgttgttgccagtggtattcgtccaaacacgacccatcatcgttca
ttcgaagcggacgaggcaacggaactgatgcgacgatgttgggcggaggaccccacagaa
aggcccgactttgggcacttgaagggggcgattcgacggctcaataagtctcaagaaagt
agtaatatattagataatttgttatcacgtatggagcaatatgccaataatttagaagca
ttagttagtgaaagaactcaagattatttagaagagaagaagaaatgcgaggaacttctt
tatcaattattacctaagtcagtggcttcgcagctcataaatgggcaatcagtagtcgcc
gagacgttcgagagcgttaccatatacttttcggacatagtcggcttcaccgcgttatct
gcctcctccacgcctatgcaagttgtcgacctcctcaacgatctctatacgtgcttcgat
tcaatcgttgaaaattacgatgtctataaggtggaaacaataggtgatgcgtacatggtg
gtgtccggtcttccggaacgtaatggtacacggcacgcccgcgaggtggcgcgtatggcc
ctcgcattgcttgacgccgtcagacgcttccggataagacaccgaccgcacgatcagctc
aaacttagaatcggtttgcattctggtccttgcgtcgccggggtagttggtttgaaaatg
ccgcggtactgcttgttcggtgacacagtaaacacggcgtcacgaatggagtcaaacgga
gaagctctcaagatacacgtgtcgccgactacgaaggctctgttggacagcttcggtaca
ttccgtctagagtgtagaggagaagttgctatgaagggtaaaggagttctagtcacgtat
tggttgttaggcgaaataatcgatccgaatgctcctaaagaaaaacctcatatagcgaag
ttacagctgcaatcgaatgttagcggatcattgtcacatctgacaccgttcaagcaacga
ttagaccacgggtcgagatcatcgagtagacgcggctctggcatatttcagcagcaaaaa
gcgaatgatgtacataaattagaaaaagaaattcaaccgttcctacaagttattaaaatg
caaagacagctgtcggagcccacggaagctgtaacaaatggagtcgaagatcactctaca
gagactgacaagttaaaccctcctaattcaatagcactcaacgtcagcactctcaatcac
aattcagtcaatcaaagtggccaacccaaagtgaaactcaaggaatgtcaaattaattct
attgggaatcacaaatcgaataagataggaaataataattggctaccaaaaatatctaca
gctagttcctttgatagcgcttctaaaaagagtacggaatgtttgaaagattacagcgga
gtaccgttgttgtccaaggctgaaactcccaatgattcaatcgtctag

DBGET integrated database retrieval system