KEGG   Papilio machaon (common yellow swallowtail): 106721268Help
Entry
106721268         CDS       T05138                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmac01001]
    106721268
Enzymes [BR:pmac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106721268
Protein kinases [BR:pmac01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   106721268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 106721268
NCBI-ProteinID: XP_014371661
UniProt: A0A0N1PH98
Position
Unknown
AA seq 347 aa AA seqDB search
MNNVARTPKTTPITDDYDISNTVLGLGINGKVVECKEKRRGVKRALKVLHDSAKARREVE
LHWRASGCIHIVEIIDVYDNTYAGKRCLLVVMECMDGGELFQRIQDNREGAFTERQAAEI
MHSICVAVRHLHDSDIAHRDIKPENLLYTSMEPHAILKLTDFGFAKETLSQADTLQTPCY
TPYYVAPEVLGPEKYDKSCDIWSLGVVMYILLCGFPPFYSNHGLAISPGMKKRIRLGQYD
FPEPEWSNVSVEAKNLIRGMLSVDPAKRLTIHQVMSSPWVRQYTQVPQTPLYTHTLLRDA
GEAWADVQDEMTRSLATMRVDYDQVQIKALEQSNNSLLNKRRNKVGA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgtcgccagaacaccgaagacaacaccaataactgatgattatgatatctca
aacacagtccttggtcttgggattaatgggaaggtggtcgaatgcaaagaaaaaagaagg
ggagttaaacgtgcattgaaggttttacacgacagtgcgaaagctagacgggaagtggag
ctgcattggagagcgagcggctgcatacatatcgttgaaataatagatgtatacgacaat
acgtacgctggtaagagatgtctgctcgttgtaatggagtgtatggacggcggagaactg
ttccagaggatccaggataatagagagggagcgttcactgagagacaggctgctgagata
atgcactctatatgcgttgcggtgcgtcacctgcacgactctgacatcgctcacagggac
atcaagcctgagaacttgctctacaccagtatggagccccacgctatacttaaacttacg
gattttggattcgcgaaggagaccctgtcacaggcggatacgttgcaaacgccctgttat
acgccgtattacgttgctcctgaggtcttaggtccagagaaatatgacaagtcttgtgac
atttggtccctgggcgttgtcatgtacatcctgctgtgtggctttcccccattctactct
aaccacggcctcgccatatcaccaggaatgaaaaagagaattcgtctcggtcaatacgac
tttccagaacctgagtggtcgaatgtatctgtcgaggccaagaatctgatccgcggtatg
ctgtccgtggatcccgccaagcgactcacgatacatcaggtgatgtcaagtccgtgggtg
cgacagtacacacaagtgccgcagacgccgctgtacacgcacacgctgctgcgtgacgcg
ggcgaggcctgggctgacgtacaggacgagatgacgcgctccctcgccaccatgcgtgtt
gactacgaccaggtacaaatcaaagcattggaacagagcaacaattccctattaaataag
agacggaacaaagttggcgcctga

DBGET integrated database retrieval system