KEGG   Prauserella marina: BAY61_02770Help
Entry
BAY61_02770       CDS       T04988                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pmad  Prauserella marina
Pathway
pmad03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pmad00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BAY61_02770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pmad03011]
    BAY61_02770
Ribosome [BR:pmad03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BAY61_02770
  Bacteria
    BAY61_02770
  Archaea
    BAY61_02770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ASR34089
UniProt: A0A222VJI9
Position
642962..643375
Genome map
AA seq 137 aa AA seqDB search
MNVREEGAAVEELPTAYARARFVRDSPTKVRRVIELIKGRNANEALAVLRFAPQTASDPV
AKVLASAMANAENNLDLDPDTLWIKNAYADEGPTLKRIRPRAQGRAYRIRKRTSHITVEV
ESRPEAKSKSKKKAGGR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgcgtgaggagggtgcagccgtggaagaactgccgacggcttacgcccgggct
cgcttcgtccgggactcgccgaccaaggtgcgccgggtgatcgagctgatcaagggtcgc
aatgccaacgaggctcttgccgtgctccggttcgcgccgcagacggccagcgacccggtg
gcgaaggtgctcgcgagcgccatggccaacgccgagaacaacctcgacctcgatccggac
acgctctggatcaagaacgcttatgccgacgagggcccgaccctcaagcgcatccggccg
cgtgcccagggccgcgcttaccggattcgcaagcggacgagccacatcacggtcgaggtc
gagtcgcggccggaagccaagtccaagagcaagaagaaggcaggtggccggtag

DBGET integrated database retrieval system