KEGG   Prauserella marina: BAY61_06495Help
Entry
BAY61_06495       CDS       T04988                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
pmad  Prauserella marina
Pathway
pmad00020  Citrate cycle (TCA cycle)
pmad00620  Pyruvate metabolism
pmad01100  Metabolic pathways
pmad01120  Microbial metabolism in diverse environments
pmad01200  Carbon metabolism
pmad01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAY61_06495
   00620 Pyruvate metabolism
    BAY61_06495
Enzymes [BR:pmad01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     BAY61_06495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp Biotin_lipoyl_2 ATP-grasp_3 HlyD_D23 GCV_H ATP-grasp_4 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ASR34685
UniProt: A0A222VL92
Position
1431582..1434965
Genome map
AA seq 1127 aa AA seqDB search
MFRKVLVANRGEIAIRAFRAAYELGAGTVAVFPHEDRNSLHRLKADEAYEIGEQGHPVRA
YLSVDEVVRAARMAGADAVYPGYGFLSENPDLARACEEAGIAFVGPSADILELTGNKARA
VAAAREAGVPVLGSSAPSSDVDELVEAAGELGFPVFVKAVAGGGGRGMRRVGDPKQLRES
IEAAAREAESAFGDPTVFLEKAVVEPRHIEVQILSDGTGGEDGVIHLYERDCSVQRRHQK
VIELAPAPNLDPELRERICADAVKFAKQIGYRNAGTVEFLVDRDGNHVFIEMNPRIQVEH
TVTEEVTDVDLVQSQLRIAAGETLSELGLTQDSVYLRGAAMQCRITTEDPANGFRPDTGM
ISAYRSPGGSGIRLDGGTAFAGTEISAHFDSMLVKLTCRGRTFKTAVGRARRALAEFRIR
GVATNIPFLQAVLDDADFQEGRVTTAFIEERPHLLTARHSADRGTRLLNYLADVTVNKPN
GERPRLINPETKIPPLPDGPPPPGSKQRLTELGPEGFARWMRESPNVGVTDTTFRDAHQS
LLATRVRSKDLLAIAPVVAKTVPQLLSVECWGGATYDVALRFLAEDPWERLAGLREAIPN
VCLQMLLRGRNTVGYTPYPTEVTDAFVDEATRTGIDIFRIFDALNDVEQMRPAIDAVRAT
GTAVAEVALCYTSDLSDPAEKLYTLDYYLKLAEQIVGAGAHVLAIKDMAGLLRAPAAAKL
VTALRKEFDLPVHIHTHDTAGGQLGSYLAAINAGADAVDGAVASMAGTTSQPSLSAIVAA
TDFSARPTGLDLQAIGDLEPYWEIVRKIYAPFEAGLASPTGRVYHHEIPGGQLSNLRTQA
KALGLGDRFEDIEAMYAAADRMLGHLVKVTPSSKVVGDLALHLVGAGVAPEDFEADPGKY
DIPDSVIGFLRGELGDPPGGWPEPFRTKALAGRANAKPVAELSEEDKGDLAADRRGTLNR
LLFPAPTQEYVAHKEAYGDTSVLPSKDFFYGLRPGEEYSVDLEQGVRLLIELEAIGEADE
RGVRTVMATLNGQLRPIQVRDLSVAADLPAKEKADKGNDRHVAAPFAGVVTAQVAEGDTI
EAGDTVATIEAMKMEAAITAQVGGIVQRLAINSVQQVEGGDLLIVLE
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcaaagtgctcgtcgccaacaggggcgagatcgccattcgcgcgttccgtgct
gcctacgaactgggcgcgggcacggtcgccgtgttcccgcacgaggatcgcaattcactg
caccggctcaaggccgacgaggcgtacgagatcggcgagcaaggccaccccgtgcgggcc
tacctctccgtcgacgaggtcgtccgcgccgctcgcatggccggagccgacgccgtctac
cccgggtacggatttctgtcggagaaccccgatctggccagagcgtgcgaggaagcggga
atcgccttcgtcggcccttccgccgacatcctcgaactgaccggcaacaaggcgcgcgcc
gtcgccgccgcccgcgaggcgggcgtgcccgtgctcggctcgtcggcgccctcgtccgat
gtggacgaactggtcgaggcggctggcgaactcggattccccgtcttcgtcaaggccgtc
gccggtggcggcgggcgcggcatgcgcagggtcggcgaccccaagcagctcagggagtcc
atcgaggcagcggcgagggaagccgaatccgccttcggtgaccccaccgtcttcctggag
aaggcggtggtcgagccccgccacatcgaggtgcagatcctcagcgacggcaccggtggc
gaggacggcgtcatccacctctacgagcgcgactgttccgtgcagcggcggcaccagaag
gtcatcgaactcgcccccgcgcccaatctggatccggaactgcgggaacggatctgcgcc
gacgcggtcaagttcgcgaagcagatcggctaccgcaacgcgggcaccgtcgaattcctc
gtcgaccgcgacggcaaccacgtcttcatcgagatgaacccgcgcatccaggtcgagcac
acggtgaccgaggaggtcaccgacgtcgacctcgtgcagtcgcagttgcggatcgcggcg
ggtgagacgctgtcggagctcggcctcacccaggactcggtctaccttcgcggcgccgcc
atgcagtgcaggatcaccacggaggatccggccaacggcttccggccggacaccggcatg
atcagcgcctaccgctcgcctggcggctccggcatccggctcgacggcggaaccgccttc
gccggcaccgagatcagcgcgcacttcgactcgatgctcgtcaagctcacgtgcagggga
aggacgttcaagaccgccgtcggaagggcgcgcagggcgctcgccgagttccgcattcgc
ggtgtggcgacgaacatcccgttcctgcaagccgtgctcgacgacgccgacttccaggaa
ggccgggtcaccacggcgttcatcgaggaacggccgcacctgctcaccgcgcggcactcc
gcggacaggggcacgcgcctgctcaactacctcgccgacgtcacggtcaacaaaccgaac
ggcgaacggccgaggctcatcaacccggagaccaagatcccgccgctgcccgacggtcct
ccgccgccgggatcgaagcagcggctcactgaactcgggccggagggcttcgcccggtgg
atgcgggagtcgccgaatgtcggcgtcaccgacaccaccttccgcgacgctcaccagtcc
ctgctcgcgacaagggtgcgcagcaaggacctgctcgccatcgcgccggtcgtcgccaag
accgttccccagctgctttcggtcgaatgctggggcggggcgacctacgacgtcgcgctg
cgcttcctcgccgaggacccgtgggaacggctcgccggactgcgtgaggcgatccccaac
gtgtgcctgcagatgctgctgaggggacgcaacaccgtcggctacaccccgtatcccacc
gaggtgaccgacgcgttcgtcgacgaggcgaccaggaccggcatcgacatcttccgcatc
ttcgacgcactcaacgacgtcgagcagatgcggcccgcgatcgacgcggtgcgcgcgacg
ggaacggcggtcgccgaggtggcgctgtgctacacctcggacctttcggatccggccgag
aagctgtacacgctcgactactacctcaagctcgccgagcagatcgtcggcgcgggcgcg
cacgtgctcgcgatcaaggacatggcgggactgctgcgggcaccggccgcggcgaagctg
gtcaccgcgctgcgcaaggaattcgaccttccggtgcacatccacacgcacgacacggct
ggcggtcagctcggcagctatctcgcggcgatcaacgcgggagccgacgcggtcgacggt
gccgtcgcgtccatggcgggcaccacctcgcagccgtcgctgtcggcgatcgtggcggcg
accgacttctcggcgaggccgacgggcttggatctccaggccatcggtgatctggagccg
tactgggagatcgtgcgcaagatctacgcgccgttcgaggcggggctggcctccccgacc
gggcgggtctatcaccacgagatcccgggagggcagctctccaacctgcgtactcaggcg
aaggcgctcggtctcggcgaccggttcgaggacatcgaggccatgtacgccgcggctgac
cggatgctcggtcacctcgtgaaggtcacgccgtcctcgaaggtcgtcggtgacctcgcg
ctgcacctcgtcggcgcgggcgtcgcgccggaggacttcgaggccgaccccggcaagtac
gacatcccggactcggtcatcgggttcctgcgcggcgaactcggtgacccgcctggcggc
tggcccgaaccgttccgcaccaaggcactcgcgggaagggcgaacgcgaaacccgtcgcc
gaactgtccgaagaggacaagggcgacctcgccgccgaccggcgcggcacgctgaaccgg
ttgctgttccccgcgccgacccaggagtacgtcgctcacaaggaggcatacggcgacacg
agcgtgttgccgagcaaggacttcttctacggcttgcggccgggcgaggagtactcggtc
gatctcgaacagggcgttcggctgctcatcgaactggaggccatcggcgaggccgacgag
cgcggtgtgcggaccgtcatggccacgctcaacggtcagctcaggcccatccaggtgcgg
gacctttcggtcgcggccgacctgcccgcgaaggagaaggcggacaagggcaacgaccgg
cacgtcgccgctccgttcgctggggtggtcacggcgcaggtcgccgagggcgacacgatc
gaagcgggggacactgtcgcgaccatcgaggcgatgaagatggaagccgccatcaccgcg
caggtgggtggcatcgtgcaacgactggcgatcaactcggtgcagcaggtcgaaggcggt
gacctgctgatcgtcctggagtga

DBGET integrated database retrieval system