KEGG   Prauserella marina: BAY61_08360Help
Entry
BAY61_08360       CDS       T04988                                 

Definition
(GenBank) fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
pmad  Prauserella marina
Pathway
pmad00051  Fructose and mannose metabolism
pmad01100  Metabolic pathways
pmad01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BAY61_08360
Enzymes [BR:pmad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     BAY61_08360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N alpha-hel2
Motif
Other DBs
NCBI-ProteinID: ASR34992
UniProt: A0A222VMB9
Position
complement(1832359..1833636)
Genome map
AA seq 425 aa AA seqDB search
MARIVALRTHDVRFPTSLTLDGSDAMNPDPDYSAAYVRVLTDAADGHEGHGFVFTIGRGN
DVQVAALRALESHLTGRDVDGTLADLGGLWRELVHDSQLRWLGPEKGIMHMAVGAVVNAL
WDLRAKREGKPLWLLLSSLTPEQIVDLVDFRYLTDALTRDEALAILRGAERGRAEREATL
LREGYPAYSTTPGWLGYDDDKLRRLCAQAVDEGFGRIKLKVGADLADDIRRLTIARQTCG
PGFPIAVDANQRWDVDEAIAWIAALGEFDLAWVEEPTSPDDVLGHAAIAKAIAPVPVATG
EHIANRVVFKQFLQAGALQILQLDATRVAGVNENIAILLLAAKFGVPVCPHAGGVGLCEA
VQHLAMFDFVAVSGTAENRTIEFVDHLHEHFVTPVDVRAGRYHAPKATGAGTEMHRSSIV
DYSHG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtggctcgcatcgttgccctgcgtacgcatgacgtgcggtttcccacctcgctcacgctc
gacggttccgacgccatgaaccccgaccccgactattcggccgcctacgtccgcgtcctc
accgacgcggccgacggacacgaaggccacggattcgtcttcaccatcggcagaggcaac
gacgtgcaggtcgcggcactgcgcgcgctggaaagtcacctcaccggcagggacgtcgac
ggcacgctcgcggacctcggcggactgtggcgcgaactcgtccacgattcccagttgcgc
tggctcggccccgagaagggcatcatgcacatggcggtcggggccgtcgtcaacgcgctg
tgggatctgagggccaagcgcgagggaaaaccgttgtggctactgctgtcctcgctgact
cccgagcagatcgtcgacctggtcgacttccggtacctcaccgacgcgctgacccgcgac
gaggcactcgcgatcctgcgcggggccgagcggggcagagccgaacgcgaggccacgttg
ctgcgcgagggatatccggcctactccacgacaccgggctggctcggctacgacgacgac
aaactgcgcaggctctgcgctcaggccgtcgacgagggattcggccgcatcaagctcaag
gtcggcgccgacctcgccgacgacatccgcaggctcacgatcgcacggcagacctgcggt
cccggcttccccatcgccgtcgacgccaaccagcgctgggacgtcgacgaggccatcgcc
tggattgccgcgctgggcgaattcgatctcgcctgggtcgaggagccgacgagccccgac
gacgtgctcgggcacgccgccatcgccaaggccatcgcccccgtgcccgtcgccaccggc
gagcacatcgccaacagggtcgtcttcaagcagttcctccaggcgggagcgcttcagatc
ctgcaactcgacgcgacgagggtcgccggtgtcaacgagaacatcgcgatcctgttgctc
gcggccaagttcggcgttcccgtgtgcccgcacgccggaggcgtcggcctgtgcgaggcc
gtgcagcatctggcgatgttcgacttcgtcgcggtgtcgggcaccgccgagaaccggacc
atcgaattcgtcgaccatcttcacgagcacttcgtcacgcccgtcgacgtccgagcgggc
cggtaccacgccccgaaggccactggggccggaaccgagatgcaccgatcatccattgtg
gattactcgcatggttag

DBGET integrated database retrieval system