KEGG   Prauserella marina: BAY61_17650Help
Entry
BAY61_17650       CDS       T04988                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
pmad  Prauserella marina
Pathway
pmad00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pmad00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAY61_17650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmad01007]
    BAY61_17650
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmad03016]
    BAY61_17650
Enzymes [BR:pmad01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     BAY61_17650
Amino acid related enzymes [BR:pmad01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BAY61_17650
Transfer RNA biogenesis [BR:pmad03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BAY61_17650
 Prokaryotic Type
    BAY61_17650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1 tRNA-synt_1f tRNA-synt_1g
Motif
Other DBs
NCBI-ProteinID: ASR36525
UniProt: A0A222VRF6
Position
3779626..3780771
Genome map
AA seq 381 aa AA seqDB search
MTFESMTRKRPIAGASAVSIGGHRVRLLDRARIYACGVTPYDVTHVGQAATFLWVDTLAR
VLRVLGVEPLVCRNVTDVDDVLHDVARHRGTPYDQLASFEQFEFEGDMAALGVRAPDHAP
VAHGFIDPVRRLAAALVESGTAYAREGSVYFRGAGVADRAGLDEETALRLAEANGGRPDD
PAKDHPLDVAVWQAAEPGHPAWSSPWGRGRPGWHAGCVAMATSVFGIGVDIHAGGADLRF
PHHAYHAAMAEALTGTAPYARAWLHAGTVRVGGVKMAKSEGNLVAVRDVLAEHPAPVLRL
AVIDRPWHSDWDYAPSVLDAAAGRLAKLYRAAGRPGESDEAVVEKLRLLLADELDVPAAI
DLATEVGGSAARLLVATMGLT
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgagtccatgacacggaagcggccgatcgcgggggcgagcgccgtgagtatc
ggcgggcatcgggtgcggttgctcgatcgcgccaggatctacgcgtgcggggtcacgccc
tacgacgtgacccacgtcgggcaggcggccacgttcctgtgggtcgacacgctggcacgg
gtgctgcgcgtgctcggcgtcgaaccactcgtctgccgcaacgtcaccgacgtcgacgac
gtcctgcacgacgtcgcgcgacaccggggcacgccctatgaccagctggcctccttcgag
cagttcgaattcgagggcgacatggccgcgctcggcgtgcgggcgcccgatcacgctccg
gtcgcgcacggtttcatcgacccggttcgcaggctcgccgccgccctcgtcgaatcggga
accgcctacgcgcgcgaggggtcggtctacttccggggagccggggtcgcggacagggcg
gggctggacgaggaaacggcgctgcggctcgccgaggccaacggcggaagaccggacgat
ccggcgaaggaccatccactggacgtcgcggtgtggcaggcggccgaacccggccacccc
gcgtggagttccccgtggggcaggggcagacccggctggcacgcggggtgtgtggccatg
gcgacgtcggtgttcgggatcggggtcgacatccacgcgggcggtgccgatctgcggttc
ccgcaccacgcctatcacgcggcgatggccgaggcgctgaccggcaccgccccgtacgcg
cgggcgtggctgcacgcggggacggtgcgggtcggcggcgtgaagatggcgaagtcggag
ggaaacctcgtggctgtccgggatgtgctcgccgagcatccggctccggtgctgcgactg
gccgtgatcgaccggccgtggcacagcgactgggactacgccccttcggtgctcgacgcg
gctgccgggcggctggcgaagctgtaccgagcggcggggcggccgggagagtcggatgaa
gccgtggtcgagaagctgcggctgctgctggccgatgaactcgacgtaccggccgccatc
gacctcgcgaccgaggtgggcggcagcgccgcccggctcctggtcgccaccatgggcctg
acctga

DBGET integrated database retrieval system