KEGG   Prauserella marina: BAY61_19415Help
Entry
BAY61_19415       CDS       T04988                                 

Definition
(GenBank) hypothetical protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
pmad  Prauserella marina
Pathway
pmad00903  Limonene and pinene degradation
pmad00930  Caprolactam degradation
pmad01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pmad00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BAY61_19415
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BAY61_19415
Enzymes [BR:pmad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     BAY61_19415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S15 COesterase
Motif
Other DBs
NCBI-ProteinID: ASR36804
UniProt: A0A222VSB9
Position
complement(4157122..4158081)
Genome map
AA seq 319 aa AA seqDB search
MASESSERLTELYRSLAARMAECPDMDLATMRDLFEELHVVTREPENVCYAETDVNGVPA
LWCVPKECAVDRVLLYFHGGGFMVGSMYLHRKLAGHLASAVGARALVLNYRLAPEHPFPA
QIEDGVTAYRWLLGQGIPARQIASVGDSAGGNLCTTVVLRLRELGLPLPAAIAPMSPWYD
LTLSSETLETNAPLDAVVQKPILEGMRAALLGSVRPDDPRINPLWADLRGLPPMLIHTGG
HETLLDDTHRFAEHAERAGVSVSVHVVPEMQHDFTLLAGHAPEADNAIRVMGEWMRERIG
LTVPAAAPVNARILESNLV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgagtcttctgagcggctgaccgaactttaccgatccttggccgcgcgtatg
gccgaatgccccgatatggacctcgcgaccatgcgggacctgttcgaggaattacatgtc
gtgacacgggaaccggagaatgtttgctacgcggagaccgatgtcaacggagttcccgcg
ttgtggtgtgtgccaaaggaatgcgcggtcgaccgggtgctgttgtatttccacggtggt
ggcttcatggtcggctcgatgtatttgcatcgaaaactcgccgggcatctcgccagcgcg
gtcggcgcccgtgcgctggtcctgaactaccggctcgcccctgaacacccgttccccgcc
cagatcgaagacggggtgaccgcctatcgatggctgctggggcaaggaattccggcccgg
cagatcgcctccgtcggcgactcggccgggggcaacctctgcacgacggtcgtgttgcgg
cttcgcgaactcggactgcccttgcccgcagcgatcgcgccgatgtccccgtggtacgac
ttgacactgtcgtcggaaacgctggagaccaacgctccgctggacgcggtcgtgcaaaag
cccatcctggaaggaatgcgcgccgctttgctcggttcggtgcgtcctgacgatccacgt
atcaatccattgtgggcggacctcagggggctgccgccgatgctcatccacaccggcggt
catgaaacgttactggacgacacccaccggttcgccgagcatgccgagcgtgcgggtgtc
tccgtgtctgtccatgttgtcccggagatgcagcacgactttactctgctcgctggacat
gctccggaagcggacaacgcgatccgcgtgatgggggagtggatgcgcgagagaatcggc
ctgaccgtgcctgccgccgctcctgtcaatgcccgcattcttgagtccaatctggtctga

DBGET integrated database retrieval system