KEGG   Prauserella marina: BAY61_24600Help
Entry
BAY61_24600       CDS       T04988                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pmad  Prauserella marina
Pathway
pmad00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pmad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAY61_24600
Enzymes [BR:pmad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BAY61_24600
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BAY61_24600
    1.1.1.-  
     BAY61_24600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N Pyr_redox_2 Pyr_redox_3 AlaDh_PNT_C NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ASR37656
UniProt: A0A222VUN6
Position
5381847..5382896
Genome map
AA seq 349 aa AA seqDB search
MSTAKYAHVTAPKQLTISEEPVPEPAADGVIVDVAYTGICGTDVHGYQSPDFLPPAVFGH
EWTGTVRAVGSAVTTVEAGQRVIASVGTACGRCAACRAGFADMCELVFAEANGIDDTAPV
HGAFATSIAVSQRRIQPVLDGLTDAQAGLVEPTAVTFHAVKRTRQPLGALVVVQGAGPIG
LLTAQHARHAGARDVVVVELNEARRRTATELGFPAVFAPGDDFTRHLEQATGGLGADVLY
ECTGAPGLLQSSAELVRRGGVLSLLGYPMTNSEVSYGDWQSRQLTVVASLAYTHDDFVGA
MAAIANGAVDVDALHSRTIGLDGLAGVLEELGSGTSTDIKVLVDPSRGA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaccgccaagtacgcccacgtcaccgcgccgaagcagctcaccatcagcgaggaa
ccggtaccggagcccgccgccgacggtgtgatcgtcgacgtcgcctacacgggtatctgc
ggcacggacgtccacggataccagtcgccggatttcctgccgcccgcggtgttcgggcac
gagtggacgggaaccgtgcgtgccgtcggctccgcggtcaccaccgtcgaagccgggcag
cgggtgatcgccagcgtgggtaccgcgtgcggccggtgcgcggcctgccgcgccgggttc
gccgacatgtgcgagctggtgttcgccgaggcgaacggcatcgacgacacggcacctgtc
cacggtgccttcgcgacgagcatcgccgtgtcacagcgcagaatccagcctgtcctggat
ggactgaccgacgcgcaggcgggtctggtggagccgacggcggtcacgttccacgccgtc
aagcgcacgcggcagcccctcggcgcgttggtcgtcgtacagggcgcgggacccatcggg
ctgctcaccgcccagcacgcccggcacgcgggtgcccgcgacgtggttgtcgtggaactg
aacgaggcccgccgtcgcaccgcaaccgaactcggtttccctgccgtgttcgcgccgggt
gacgacttcacgcggcatctcgaacaggcaaccggcgggctgggcgccgacgtgctgtac
gagtgcaccggcgcgcccggccttctccagtcgtcggcggagctcgtgcgccgaggcggg
gtgctctcgctgctcggctacccgatgacgaactccgaggtgagttacggcgactggcag
agcaggcagctcaccgtcgtcgcctcgctcgcctacacccacgacgacttcgtgggcgcc
atggccgcgatcgcgaacggcgccgtcgacgtcgacgccctgcactcccgcacgatcggt
ctcgacggcctcgccggggtactcgaggaactcggttcggggacgagcaccgacatcaag
gtgctcgtggacccgagtcgcggcgcctga

DBGET integrated database retrieval system