KEGG   Parus major (Great Tit): 107198219Help
Entry
107198219         CDS       T04864                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase 1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00010  Glycolysis / Gluconeogenesis
pmaj00030  Pentose phosphate pathway
pmaj00051  Fructose and mannose metabolism
pmaj01100  Metabolic pathways
pmaj01200  Carbon metabolism
pmaj04910  Insulin signaling pathway
Module
pmaj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107198219
   00030 Pentose phosphate pathway
    107198219
   00051 Fructose and mannose metabolism
    107198219
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107198219
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmaj04147]
    107198219
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     107198219
Exosome [BR:pmaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107198219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 107198219
NCBI-ProteinID: XP_015470520
Position
Z
AA seq 339 aa AA seqDB search
MTDRSTFDTNVITMTRFVMEEGRRAKGTGEFTQLLNSLCTAIKAISTAVRKAGIANLYGI
AGSTNVTGDQVKKLDILSNDLVINMLKSSFSTCVIVSEENKDAVIVETEKQGKYIVCIDP
LDGSSNIDCLVSIGTIFAIYRKVSPDEPSGKDALQPGRNLVAAGYALYGSATMLVLATPA
GGVNCFMLDPAIGEFILVERDVKIKKKGNIYSLNEGYAKYFDPAVTEYLKKKKFPEDGSS
PYGGRYIGSMVADVHRTLVYGGIFLYPANSKSPKGKLRLLYECNPMAFVIEKAGGIATTG
QQAVLDIVPEDIHQRVPVVLGSPDDVKEYLEIVKKHSTK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccgctccaccttcgacaccaatgtcatcaccatgacccgcttcgtgatggag
gaaggcaggcgggccaagggcaccggggagttcacgcagctcctcaactccctctgcacg
gccatcaaagccatctccaccgccgtccgtaaagcgggcatagccaacctctatggaatt
gctgggtctaccaatgtgaccggagaccaagtaaaaaagctggatattctgtccaatgac
ctggtgattaacatgctgaagtcatccttcagtacatgtgttatcgtgtccgaagaaaac
aaagatgctgtgatagtggaaactgaaaaacagggtaaatacatagtctgcatagaccct
ctagatggttcatcgaacattgactgtcttgtttccattgggaccatctttgcaatttat
agaaaggtgtcccctgatgaaccttctgggaaagatgccttacagcctgggcgtaatctt
gtggcagctggttatgcgctctatgggagtgccaccatgctggtactggccactcctgct
ggaggtgtcaactgtttcatgctggatccggcaattggagaattcattttagtggaaaga
gatgtgaaaatcaaaaagaagggaaatatctacagtctcaatgaaggctatgctaaatat
tttgatcctgctgtcacagagtacctcaaaaagaagaaattccctgaggatggcagttca
ccgtatggtgggaggtacataggatccatggtggccgacgtgcatcgtacactggtgtat
ggaggaatctttctgtatcctgctaactccaaaagtcccaaaggaaagctgagactgctc
tacgaatgcaatcctatggcctttgttattgagaaggctgggggaatagcaacaactggt
cagcaagcagtactagatatagtgcctgaggatatccaccaaagagtgcctgttgtcttg
gggtctcctgatgatgtgaaggagtaccttgagatagtcaagaagcattcaactaagtaa

DBGET integrated database retrieval system