KEGG   Parus major (Great Tit): 107198335Help
Entry
107198335         CDS       T04864                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00511  Other glycan degradation
pmaj00600  Sphingolipid metabolism
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107198335
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107198335
Enzymes [BR:pmaj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     107198335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N DUF5127 Bac_rhamnosid6H GDE_C
Motif
Other DBs
NCBI-GeneID: 107198335
NCBI-ProteinID: XP_015470765
Position
Z
AA seq 851 aa AA seqDB search
MAAAEEPLMRRYEGAAKGRGVAADGWRVCLAHSFEELRQPYGAGDVPLRDVLRHIGLGLR
YFRWWFKKTRIEKKSAFIDLLCAVPLQQIYGCPLGGIGGGTITRGWRGEFCRWQLNPGLY
HYETVIANQFTVCLRCKGQTIYQQVLSVERPSRLQGWNWGYCGRYAFYHALYPRAWLVYE
LPGQKVVLTCRQLSPVIPHDYQDSSLPVGVFIWEVENERDEDVEVSIMFSLQNGTGAEED
GSGGHWNEPFTFQKDGERVAGVLLHHCPAVNSFTLAISAREKAGTGVTHVTAFNPMGLGR
EVWQDLLQDGRLDSPTGKSRPTEKGEVTAAAVCASCQVPAHGHKTLEFALAWDMPCVHFG
SKEKLHLRRYTRFFGSKGDAAPALSHYALTHYKEWERKIEAWQNPILENSQLPSWYKSAL
FNELYFMTDGGTIWMEVPPDCCAEDLQGPAGAGLSHLLPVLREYGRFAYLEGQEYRMYNT
YDVHFYASFALIMLWPKLQISLQYDIAVTVVNEDVQPRQYLMCGQTAQVKMKNVVPHDIG
DPGDEPWQRVNAYLMHDTADWKDLNLKFVLQVYRDYYLTHDSLYLQDMWPVCQAVMESEL
KFDTDNDGLIENGGFADQTYDAWVVHGASAYCGGLWLAAVCMMCKMAEVLGDTEIQQKYL
GILKKGKEAFERMLWNGKYYNYDSSGSDTSSSIMSDQCAGQWFLGVCGLDHEVFPKSHVL
SALKTIFEKNVLSFAGGTMGAVNGMRPDGVPDTSSVQSSEVWVGVVYSLAATMIQEGMVE
EGFRTAEGCYRTVWERLGMAFQTPEAYREKKVYRSLAYMRPLSIWSMQLALEHRAGQAPA
PAQLRQGPTHP
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggaggagccgctgatgcggcgctacgagggggcagcgaagggccgcggc
gtggcggcggacggctggcgcgtctgccttgcacacagcttcgaggagctgcggcagccc
tacggcgccggggacgtgccgctccgcgatgtcctgcggcacattggcctcggcttgcga
tacttcaggtggtggttcaagaagacccgcatagagaagaaatctgccttcattgacctc
ttgtgtgctgttcctctgcagcagatctatgggtgtccgctgggtgggatcggaggaggc
accatcacccgtggctggcggggagagttctgccgctggcagctgaaccctggcctttac
cactacgaaacggtcattgccaaccagttcacggtgtgcctgcggtgcaaggggcagacg
atttaccagcaggtcttgtccgtggagagacccagcaggctgcagggctggaactggggc
tactgtggccgctacgccttttaccatgcgctgtacccccgtgcctggctggtgtacgag
ctgccggggcagaaggtggtgctgacttgccggcagctctctcccgtcatcccccatgac
tatcaggactccagcttgccagtgggagtgttcatctgggaggtggagaacgagagggat
gaggacgtggaagtgtccatcatgttcagcctgcagaacggcacgggagcggaggaggac
gggagcggtgggcactggaacgagcccttcaccttccagaaggatggcgagcgggtggct
ggagtcctgctgcaccactgcccagctgtgaactccttcactctggccatttctgcccgg
gagaaggctggcacgggagtcacccatgtcacagcattcaatcccatgggattgggcaga
gaggtgtggcaggacctcctgcaggatggcaggctggattctcccaccggtaaaagcagg
ccaacagagaagggggaggtgacagcagcagcagtatgtgccagctgccaggtgcctgcc
catgggcacaagacgctggagtttgccctggcttgggacatgccctgtgttcactttggc
tccaaggagaagctgcacctcaggcggtacacccggttttttggcagcaaaggcgatgct
gcacctgccctgtcccattacgccctgacacactacaaggagtgggagaggaagattgaa
gcgtggcagaatcccatcctggagaacagccagctgccttcctggtacaagtcagccctc
ttcaatgagctctacttcatgacggatggcggcaccatctggatggaggtgccccctgac
tgctgtgccgaggacctgcaggggccggcaggggcgggactgtcccacctcctccctgtc
ctgcgggaatacggaaggtttgcttatttggaaggccaggagtaccgcatgtacaacacc
tacgatgtccatttctacgcctccttcgctctcatcatgctgtggcccaagctgcagatc
agcctgcagtatgacattgctgtcactgtggtgaatgaggatgtccagccacgacagtac
ctgatgtgtggtcagacagcccaggtgaagatgaagaatgtggtgccacatgacattgga
gacccaggtgatgagccatggcagcgtgtcaatgcctacctgatgcacgacactgctgac
tggaaggacctcaacctgaagtttgtgctgcaggtgtaccgtgactactacctgacacat
gactccctgtacctgcaggacatgtggccagtgtgccaggctgtgatggagtcagagctg
aagtttgacacggataatgatgggctcattgaaaatggtggctttgctgaccagacatac
gacgcctgggtggtgcatggagccagtgcctactgtggtggactgtggctggctgctgtc
tgcatgatgtgcaagatggcagaagtgctcggggatactgagatccagcagaaatacctg
ggcatcctgaaaaagggcaaggaggcgtttgagaggatgctctggaatggaaaatactac
aactacgatagcagtggaagtgacacatccagcagcatcatgtcagaccagtgtgctggt
cagtggtttcttggagtttgtggtctggaccatgaggttttccccaagagtcacgttctc
agcgcgctcaagaccatctttgagaagaacgtgctgagctttgcgggtggcaccatgggg
gcagtgaacggcatgagacccgacggcgtgcctgacacctccagtgtccagtccagcgag
gtgtgggtcggcgtggtctactccctggccgccaccatgatccaggagggcatggtggag
gaaggcttccgtacggcggagggctgctacaggacggtttgggaacggctgggcatggct
ttccagacacccgaggcctatcgggagaagaaggtgtaccgctcactggcctacatgcgg
cctctcagcatctggagcatgcagctagccctggagcaccgggctggccaggcaccggca
cccgcacagctccgccagggccccacgcacccctga

DBGET integrated database retrieval system