KEGG   Parus major (Great Tit): 107199098Help
Entry
107199098         CDS       T04864                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04270  Vascular smooth muscle contraction
pmaj04350  TGF-beta signaling pathway
pmaj04510  Focal adhesion
pmaj04530  Tight junction
pmaj04810  Regulation of actin cytoskeleton
pmaj05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107199098 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107199098 (ROCK1)
   04530 Tight junction
    107199098 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107199098 (ROCK1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107199098 (ROCK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107199098 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmaj01001]
    107199098 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmaj03036]
    107199098 (ROCK1)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107199098 (ROCK1)
Protein kinases [BR:pmaj01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   107199098 (ROCK1)
Chromosome and associated proteins [BR:pmaj03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107199098 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH Cortex-I_coil C1_1 APH Pkinase_C DUF1192
Motif
Other DBs
NCBI-GeneID: 107199098
NCBI-ProteinID: XP_015471917
Position
2
AA seq 1366 aa AA seqDB search
MSSGESFESRFEKIDVTLKDPKSEVNVDCLLDGLDALVYDLDFPALRKNKNIDNFLNRYK
DTVNKMRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSSRRVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDSDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLGVPAENSNDNRTGS
SVDKSVLENMQKMIYELEEQLHNEMQLKDEMEQKCRSSNIKLDKIMKELDEEGSQRKNLE
TTVSQIEKDKMVLQHKINEYQRKFEQENEKRRNVENEVSTLKDQMEDLKKISQHSQISNE
KITQLQKQLEEANDLLRTESDTAARLRKGNTEMSKSLSQVESLNRELQERCRVLESTKLQ
VEKDYYQLQAALESERRDRSHGSEMIGELQVRITTLQEEVKNIKNNLDRVEAERKQAQDM
LNHSEKEKNNLEIDLNYKLKSLQDRLEQEVNEHKVTKARLTDKHQSIEEARSVAMCEMEK
KIREERAAREKAENRIVQAEKQCSMLDFDLKQSQQKLEHLLQQKERLEDEVRNLTLKLEQ
ETNKRIMAQNELKAQAFEADNLKGSEKQLKQEINTLLEAKRLLEFELAQLAKQYRGNEGQ
MRELQDQLEAEQYFSTLYKTQVKELKEEIDERNKETQRKMQELQNEKETLATQLDLAETK
AESERLARALAEEQYYELNQESKKAASRHRQELTDKDIIIRRLEETNNTLTKDVDLITKE
NTEISEKFKKQEEDYKMKKEEEINNIRMHYEKSINTERTLKTQAVNKLAEIMNRKDFKID
RKKANMQDLRKKEKENRKLQLELNQEKEKFNQIVVKYQKELNEMQAQLAEESTYRNELQM
QLDSKESDIEQLRRKIMDLQQGMDSTSVASLPTDETDGNLSESRLEGWLSVPNKGNIRRH
GWKKQYVVVSSKKILFYNDEKDKDQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIF
QILYANEGECRKDLEVEPVQPAEKTNFLNHKGHEFIPTLYHFPANCEACAKPLWHVFKPP
AALECRRCHVKCHRDHLDKKEELIAPCKVSYDVTSARDMLLLASCQDEQKKWVTHLVKKI
PKTPPSTFVRASPRTLSTRSSANQSFRKVVKNTSGKTRQYSRTCPR
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggagaaagttttgagtctcgatttgagaaaatcgacgtgactttgaaggac
cccaagtccgaagtgaacgtggactgtttgctggatggattagatgctttggtatatgac
ttggattttcctgccttaagaaaaaacaagaacattgataacttcttaaacaggtataaa
gacacagtaaacaaaatgagggatctgcgcatgaaagctgaagattatgaagtggtaaag
gtgatcggtagaggggcatttggggaggttcagttggtgaggcataaatcctcaaggaga
gtgtatgctatgaaacttctgagcaaatttgagatgatcaaaagatctgattctgcattc
ttctgggaagaaagggatattatggcttttgctaatagtccctgggttgttcagttattt
tatgcgttccaagatgaccgttacctttacatggtgatggaatacatgcctggtggggac
cttgtgaatttaatgagtaattacgatgttccagagaaatgggcaagattttatactgct
gaagttgtacttgcattagatgcaattcactcaatgggttttatacacagagatgtgaag
cctgataatatgctgctagataaagctggtcatttaaaattagcagattttggtacttgt
atgaagatgaacaaggaaggaatggtacgatgtgacacggctgtgggaacaccggactac
atctctcctgaagtattgaagtcccagggaggggatggttactatgggcgggaatgtgac
tggtggtcagttggagtcttcttgtatgagatgcttgtaggcgatacacctttttatgca
gactctttggttggaacgtacagcaagattatgaaccataagaactcccttactttccct
gatgacagtgacatttctaaagaggcaaaaaacctcatttgtgcctttttaactgatagg
gaagtgaggttaggacgaaatggtgtagaagaaattaaacggcaccttttcttcaaaaat
gatcagtgggcttgggaaacactcagagacacggtagcaccagttgtgcctgacttaagt
agtgacattgacactagtaatttcgatgatctggaagaagacaaaggagaggaagaaaca
tttcccataccaaaagcatttgtgggcaaccagcttccttttgtaggatttacgtactac
agcaaccgtcggtatttaggtgtccctgcagaaaattccaatgacaacagaacgggctcc
agtgtggacaaaagtgtgctggaaaatatgcagaagatgatctatgagttagaagaacag
ctacataatgaaatgcaattgaaagatgaaatggagcaaaagtgcagatcttcaaacata
aagctagacaagataatgaaagaactggatgaagagggcagtcagaggaagaacttagaa
acaacagtgtctcagattgagaaggacaagatggtgttacaacataaaataaatgagtac
caaagaaaatttgaacaagagaatgaaaaaagacgtaatgtggaaaatgaagtgtccaca
ctaaaagatcagatggaagacttgaaaaaaattagccagcattcacaaatttcaaatgag
aagataacacagttacaaaaacaactagaagaagcaaatgatttgctgaggacagaatct
gacacagctgcaaggctgagaaagggtaacacagaaatgagcaagtcattaagtcaggta
gaatcactgaacagagagctgcaagaaaggtgcagagttttggaaagcacaaaactgcag
gtggagaaggattattaccaactacaagcagctttggagtcagaacgaagggacagaagt
catgggtctgaaatgattggagaattacaggttcggattacaactttacaagaagaagta
aaaaacattaaaaacaatcttgatcgagtggaagcggaaagaaaacaagcacaggatatg
ctaaaccattcagaaaaggaaaagaataatttagagatagatttgaactacaaactgaaa
tccttacaagaccggttagaacaggaagtcaatgagcacaaagtgactaaagcacggtta
actgacaagcaccagtcaatagaggaggcaagatcagttgcgatgtgtgaaatggaaaaa
aagataagggaagaacgggcagcaagagagaaggcagaaaatagaatagttcaagctgaa
aaacagtgttccatgctggactttgacctgaagcaatctcagcagaaactggaacatctt
cttcagcaaaaggaaagactggaagatgaagtaaggaatctaacacttaagctagaacaa
gagacgaataagcgaataatggcacagaatgaattaaaggcacaagcttttgaagctgat
aacttgaagggttctgagaagcagctgaaacaggaaatcaataccttgttggaagcaaag
agattactggaatttgagctggctcaacttgcaaaacagtacagaggaaatgaaggtcag
atgcgtgagcttcaggatcagcttgaagctgagcagtatttttcgacactttacaaaact
caggttaaggaactgaaagaggaaattgatgaaaggaataaagaaacacaaagaaaaatg
caggagttgcaaaatgaaaaagaaacactcgctacccagttggatttagctgaaaccaaa
gctgagtcggaacggttggcacgggcacttgctgaagaacagtattatgaactgaatcag
gaaagcaaaaaagctgcatcaaggcacagacaagaattgactgataaggacatcatcata
agaaggctggaagaaactaataacactttaaccaaagatgttgatttaataacgaaggaa
aacacagagatcagtgaaaaatttaagaaacaagaggaagattacaaaatgaaaaaagag
gaggaaatcaataatattagaatgcattatgagaagagcataaacactgaaagaactctg
aagacacaggctgtcaacaaactggctgagataatgaatcggaaagattttaaaatagac
agaaagaaagctaacatgcaagatttgaggaagaaggagaaggaaaaccgaaagctccaa
ttagaacttaatcaagaaaaagagaaattcaatcagatagtcgtgaaataccaaaaggaa
cttaatgaaatgcaagcgcaactagcagaagaatctacatacaggaatgagctccagatg
cagctggatagtaaagagagtgacatagaacagctgcgaaggaaaatcatggaccttcag
caaggaatggattctactagtgttgccagtcttccgacagatgaaacagatggaaatctt
tcagaatcaagacttgaaggttggctttcagtaccaaacaaaggaaatataaggcggcat
ggctggaagaaacagtatgttgtggtgagcagtaaaaagatactgttctacaatgatgaa
aaagacaaggaccagtctaatccatccatggtactagatatagataagctgtttcacgtc
cggcctgtaactcaaggagatgtatatagagctgaaactgaagaaattcctaaaatattc
cagattctctatgctaatgagggggaatgcaggaaggatttggaggtagaaccagtacag
ccggcagagaagacaaattttctaaatcacaaaggccatgaatttattcccacgttatac
cactttccagccaactgtgaggcctgtgccaaacctctctggcatgtctttaaaccccct
gctgccctagaatgtcgaagatgccatgtgaagtgccacagagaccacttagataaaaag
gaggaattaattgcaccatgcaaagtgagttatgatgtaacttcagcaagagatatgctc
ttgttggcatcctgtcaagatgaacagaagaagtgggtgacgcatttagtaaagaagatc
cctaagacacctccatctacttttgttcgtgcttctcctagaactttgtctacaagatcc
tcagcaaaccagtcattccgaaaagttgttaaaaatacttctggaaaaactagacagtat
agcagaacttgccctcggtga

DBGET integrated database retrieval system