KEGG   Parus major (Great Tit): 107199483Help
Entry
107199483         CDS       T04864                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 14-like
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107199483
Enzymes [BR:pmaj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     107199483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE UIM
Motif
Other DBs
NCBI-GeneID: 107199483
NCBI-ProteinID: XP_015472291
Position
Unknown
AA seq 506 aa AA seqDB search
MMLAALQPRGPAGRGSPGPWPEPVASGEWDLEAEFPFAAGGDGARELLLDTGVQEEVQMA
LAIQYSMDRTWCEEQELARATALSLRSYSREREQERAEEDGELLAALEASLEEALLAADT
VRVTVFCSSEQDASAVPRELERALAARLRTREVASERLRALPAPGRCALALLRRRHAVQL
TLQGGTATLRGFPDFVEPAARELAWLLRSMPPPRHGATNTASTAHWVRWDPSGTAVSYGP
EAAAQLEQAWLRQERRLDLVLDGRPFTVDLERMEEFDIGSARAVPVCRSQPPLDSTCCLL
GPELAGLEEEVRLMPLAEDSEEFAEAAQHFCGTLEELQGQISIVQVQKLIHPVLYKQYQL
KKGSVERACAAGTAVERVLFHGTTKASSREICLHGFNRSFCGKNATLYGLGVYFAVRAAV
SARDRYSPPSASGTKFIFMAKVLTGEFAAGRAGLRAPPLREGSGVPRRYHSVVDNPRQPN
TFVIFNDTQAYPQYLITCRSRHGGPL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggcagcgctgcagccgcgcggccccgccgggcgtgggagccccggcccttgg
cccgagcccgtcgccagcggcgagtgggacctggaggccgagttccccttcgcggccggc
ggggacggtgccagggagctgctgttggacaccggcgtgcaggaggaggtgcagatggct
ctggccatccagtactccatggaccgcacgtggtgcgaggagcaggagctggcccgcgcc
accgccctgtccctgcgctcctacagccgggagcgggagcaggagcgggcggaggaggat
ggagagctgctggccgcgctggaggcctcgctggaggaggcgctgctggcggcagacacg
gtgcgggtgacggtgttctgctcctcggagcaggacgcgtcggcggtgccgcgggagctg
gagcgggcgctggcggcgcggctgcggacgcgggaggtggcgagcgagcggctgcgggcg
ctgccagcccccggccgctgcgcgctggccctgctgcgccgccgccacgccgtgcagctc
accctgcaaggcggcaccgccacgctgcgaggcttccccgacttcgtggagcctgccgca
cgggagctcgcgtggctgctccggagcatgccaccgccgcggcacggtgccaccaacacc
gccagcaccgcgcactgggtgcgctgggacccgtctggcaccgctgtctcctacggcccc
gaggccgcggcgcagctggagcaggcctggctgcgccaggagcgccggctggatctggtg
ctggacgggaggcccttcaccgtggatttggagcgcatggaggagttcgacatcggcagc
gcccgcgccgtgcccgtgtgccgcagccagcccccgctggacagcacctgctgcctgctc
gggccggagctggccgggctggaggaggaggtgcggctgatgccgctggccgaggactcg
gaggagttcgccgaggcggcgcagcatttctgcgggacgctggaggagctgcagggccag
atcagcatcgtgcaggtgcagaagctgatccacccggtgctgtacaagcagtaccagctg
aagaagggcagcgtcgagcgggcttgtgccgccggcaccgccgtggagcgcgtcctgttc
cacggcaccaccaaggcctccagccgtgagatctgcctgcacggcttcaaccgcagcttc
tgcgggaagaacgccacgctctacgggctcggcgtgtacttcgcggtgcgtgcggccgtc
tcggcgcgggatcgttactcaccgcccagcgccagcggcaccaagttcatcttcatggcc
aaggtgctgaccggggagttcgcggccgggcgagcggggctgcgggcgccgccgctgcgg
gagggctccggcgtcccccggcgctaccacagcgtggtggacaacccccggcagcccaac
accttcgtcatcttcaacgacacccaggcctacccccagtacctcatcacctgccgcagc
cgccacgggggtcccctctga

DBGET integrated database retrieval system