KEGG   Parus major (Great Tit): 107199562Help
Entry
107199562         CDS       T04864                                 

Definition
(RefSeq) retinal guanylyl cyclase 1-like
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00230  Purine metabolism
pmaj01100  Metabolic pathways
pmaj04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107199562
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    107199562
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmaj01001]
    107199562
Enzymes [BR:pmaj01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107199562
Protein kinases [BR:pmaj01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107199562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc
Motif
Other DBs
NCBI-GeneID: 107199562
NCBI-ProteinID: XP_015472368
Position
Unknown
AA seq 122 aa AA seqDB search
SVAEALKMGTPVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSH
DVYKVETIGDAYMVASGLPKRNGNRHAGEIANMSLDILSSVGTFKMRHMPEVPVRIRIGL
HS
NT seq 368 nt NT seq  +upstreamnt  +downstreamnt
gtcagtggccgaggcgctgaagatggggacgccggtggagcccgagtactttgaggaggt
gacgctgtacttcagcgacatcgtgggcttcaccaccatctcggccatgagcgagcccat
cgaggtggtcgatctcctcaacgacctctacaccctcttcgacgccatcatcggctccca
cgacgtctacaaggtggagaccatcggcgacgcctacatggtggcctcggggctgcccaa
gcgcaacggcaaccggcacgccggcgagatcgccaacatgtccctggacatcctcagctc
cgtcggcaccttcaagatgcgccacatgcccgaggtgcccgtgcgcatccggatcgggct
gcactcgg

DBGET integrated database retrieval system