KEGG   Parus major (Great Tit): 107199692Help
Entry
107199692         CDS       T04864                                 

Gene name
ERP44
Definition
(RefSeq) endoplasmic reticulum resident protein 44 isoform X1
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmaj04131]
    107199692 (ERP44)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmaj04147]
    107199692 (ERP44)
Membrane trafficking [BR:pmaj04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    107199692 (ERP44)
Exosome [BR:pmaj04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107199692 (ERP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin OST3_OST6 Thioredoxin_2 HyaE Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 107199692
NCBI-ProteinID: XP_015472505
Position
2
AA seq 431 aa AA seqDB search
MWLLERKFVSIIRLVTQGENIWSGSVALCTSQLLKNVLTWSSTHVSWLFNPARSEITSLD
SGNIDDILNNADVALVNFYADWCRFSQMLHPIFEEASNVIKEEYPDKNQVVFARVDCDQH
SDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVTAIADYIRQQKSNPIREVQDLEEISS
LDRSRRNIIGYFEQKDSDNYRTFERVANILHDDCVFLSAFGAISKAERFSGDNVIYKPPG
ENAPDMVYLGSLTNFDLIYAWTQDKCVPLVREITFENGEELTEEGLPFLILFHMKDDLES
LEKFQQEVARQLIGEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFPDF
SDLSIPGKLKQFVLDLHSGKLHREFHHGPDPTDVAPGQPIQDLASSPPESSFQKLAPSEH
RYTLLREKDEL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtggcttctggaaagaaaatttgtttccataattcgcctggtgacccagggagaaaac
atttggtctggttctgtggctctgtgtacgtcccagttgctgaagaacgttctaacttgg
tcttctactcatgtatcttggctttttaatccagcaagaagtgaaataacaagtctagat
agtggaaatatagatgacattttaaacaatgcagatgttgctttagttaatttttatgct
gattggtgccgcttcagccaaatgctgcatcctatttttgaggaagcttctaatgtaatc
aaagaagaatatccagataagaatcaagtggtgtttgctagagtagactgtgatcagcat
tctgatatagctcagaggtacaggataagcaaatatccaactctgaaactcttccggaat
ggcatgatgatgaagagggaatacaggggccagagatctgtgacagcaatagcagattac
atcaggcagcaaaaaagtaaccctattcgggaggtccaggatttggaagaaatcagttct
cttgatcgcagcagaagaaatattattgggtactttgagcaaaaggactctgataattac
agaacctttgaaagagtagcgaatattttgcatgatgattgtgtgttcctctctgccttt
ggggctatttcaaaagcagagagatttagcggagacaatgtaatctacaagccaccaggg
gaaaatgctccagatatggtgtatttaggctcactaactaattttgatttgatttatgca
tggacacaagataaatgtgtaccattagttcgagaaatcacatttgaaaatggggaggaa
ctgacagaagaaggtcttccttttctcatacttttccacatgaaagatgacttggagagt
ttagagaaattccaacaggaggttgcacggcagttaataggtgaaaaaggtacaataaac
ttcctccatgctgactgtgacaaattcaggcatccactcctccacattcagaagactcca
gcagactgccctgtcattgctattgatagcttcaggcacatgtatgtctttccagacttc
agtgacttgtcaattccaggtaaactgaagcaatttgtactagacttgcattctggaaaa
ttgcatagagagtttcatcatggccctgatccaactgatgtagcacctggtcagccaatt
caggatttagcaagcagcccaccagagagctcattccagaaactggcacccagtgaacat
aggtacaccttattgagggaaaaagatgaactttaa

DBGET integrated database retrieval system