KEGG   Parus major (Great Tit): 107200084Help
Entry
107200084         CDS       T04864                                 

Gene name
MAPK15
Definition
(RefSeq) mitogen-activated protein kinase 15 isoform X1
  KO
K19603  mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmaj01001]
    107200084 (MAPK15)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107200084 (MAPK15)
Protein kinases [BR:pmaj01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107200084 (MAPK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Pox_VLTF3
Motif
Other DBs
NCBI-GeneID: 107200084
NCBI-ProteinID: XP_015473563
Position
2
AA seq 558 aa AA seqDB search
MSPPEVEPLVCRKYEIKRRLGKGAYGIVWKAIDRKTGETVAVKKIFDAFRNRTDAQRTFR
EIMFLQEFGEHPNIIKLLDVIQAENDKDIYLIFESMETDLHAVIKKGNLLKDIHKCYILY
QLLKATKFIHSGNVIHRDQKPSNVLLDAQCCVKLCDFGLARSLCQLNEDQPSLALTEYVA
TRWYRAPEILLASRNYTKGVDMWSIGCILGEMLLGKPLFPGTSTMNQIEQILRVIPAPSP
EDILALQSEYKASVISHMSSRQRVAFEEIFPSSTPLPALDLLKKLLVFNPDKRLTAEEAL
QHPYVRRFHCPSREPSLDFDVILPLGDDVQLSVAEYRNKLYEMILENKSKSLPKEQGWRE
NIQLRQSESSTLLPAFSSVTVPIRKGQQEPTPPLLNPSHVHTGATAGDQPKGSSQKDVAR
TVCQRSQISVMMYNPITHTTVQRNANPGVGIRNCSAPPQQSRISNNENPGRQTTWINTQL
SPTSVQNLYNNPRNSQSHSKDVRPLLKPSKKMFQITANVGAVGDPKASMGSYSQAYGTIS
KSALQNLPIAKASKNPEQ
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcccgaggtggagccgctcgtgtgccgcaaatacgagatcaaaaggcgcctg
ggcaagggggcctatggcatcgtctggaaagctattgaccgcaagacaggagaaacagtt
gctgttaaaaagatttttgatgctttcaggaacagaacagatgctcagagaacatttcga
gagattatgttcctgcaggaatttggagaacatccaaatatcatcaagctgctcgatgtt
atccaagcagagaatgacaaagacatctatctcatctttgagtccatggagacagattta
catgctgtgattaagaaggggaatttgctgaaagacatccacaagtgctacattctctac
caactcctgaaggcaactaaattcatccactcagggaatgttattcacagggatcagaag
ccttccaatgtcctgctggatgcacagtgctgtgtgaagctgtgtgactttggcctggcc
cgttccctgtgccagctgaacgaggaccagcccagccttgcactcaccgagtacgtggcc
acgcgctggtaccgagcccccgagatcctgctggcctctcgcaattacactaagggtgta
gacatgtggagcattggctgtattctcggagagatgctgcttggaaagccactttttcct
ggaacatcaacaatgaatcaaatagagcagatcctgagggtcatccctgctccatcccca
gaagatattttggctctgcagtcagagtacaaggcctcagttattagccacatgagttcc
cggcagcgagtagcatttgaggagattttcccatcctctactccattgcctgccttggat
ctgctgaagaaacttctggtatttaaccctgacaaacggctcacagcagaggaggctttg
cagcatccttacgtgagaagattccactgtccttccagggagccctctttggattttgat
gtgatccttcctttgggtgatgatgtccaactgtctgtggcagaatatagaaataaatta
tatgagatgatccttgaaaataagtcaaagagccttccaaaggagcaagggtggagagaa
aacattcagctgagacagtctgaatccagcacactcctcccagctttcagctcggtgact
gtacccatcaggaaaggccagcaagaaccaacaccccctcttctaaacccttcacatgtg
cacactggagccacagctggggaccagccaaaaggatctagccaaaaggatgtggccaga
actgtatgtcagagatcacagattagtgtgatgatgtacaaccccatcacacacaccact
gtgcagagaaatgcaaatcctggtgttgggatcaggaactgttctgcaccacctcaacag
tccagaatctccaacaatgaaaatccagggagacaaaccacatggataaacactcagctc
tctcctacaagtgtgcagaacctttacaataatcctagaaactctcagagtcacagtaaa
gatgttcgtccccttctgaagcccagtaaaaagatgttccagatcactgcaaacgtggga
gctgtgggtgatccaaaggcatccatgggcagctattcccaagcttatggaaccatcagt
aaatctgcgctgcagaaccttccaatagcaaaggcctccaaaaatcctgagcagtga

DBGET integrated database retrieval system