KEGG   Parus major (Great Tit): 107200160Help
Entry
107200160         CDS       T04864                                 

Gene name
NSUN2
Definition
(RefSeq) tRNA (cytosine(34)-C(5))-methyltransferase
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
pmaj  Parus major (Great Tit)
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmaj03016]
    107200160 (NSUN2)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     107200160 (NSUN2)
Transfer RNA biogenesis [BR:pmaj03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    107200160 (NSUN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ
Motif
Other DBs
NCBI-GeneID: 107200160
NCBI-ProteinID: XP_015473729
Position
2
AA seq 796 aa AA seqDB search
MGRRARDRRRRQQQQQQQRQERGGGAGGGDQAGWAGGYPEIVKENELFERYYRELGIVPA
GEWDAFMAALREPLPATLRITGYRSHAKEILHCLKEKYFRELQDLEVDGQKVEMPQLLSW
YPEELAWHTNLSRKILRKSPQLEKLHQFLVSETECGNISRQEAVSMIPPLLLNVSPHHKI
LDMCAAPGSKTAQLIEMLHADMNVPFPNGFVIANDVDNKRCYLLVHQAKRLNSPCIMVVN
HDASSIPNLQIDVDGRKEILFYDRILCDVPCSGDGTLRKNIDVWKKWTTQNSLQLHGLQL
RIATRGAEQLAEGGRMVYSTCSLNPIENEAVIASLLEKSQGALELADVSSELPGLKRMPG
ITKWKVMLKDGQWFEEWKDVPSNRQTQIRPSMFPVKDAEKLKAMNLERCLRILPHHQNTG
GFFVAVLIKKSPMPWNKRLPKVHQKLPQRTRDTEVTAANSDNGSDCIIEEPTLSENEESK
KMQELQNLDTEQSKKEGVCGPPPSKKMKLFGFKEDPFVFLPEDDPLFLPIQRFYALDPSF
PKMNLLTRTQEGKKRQLYMVSKELRNVLLNNSEKMKVINTGIKVWSRNSDGEQFGCAFRL
AQEGIYTLYPFIHARIIDVCIEDVKILLTQENPFLSKFSSETQKKVKDMAMGSIVLKYNP
APEKPHDLQCPIVLCGWQGKTSLRAFVPKNERLHYLRMMGVEVFKAKRKEELENKTEEEV
QERLEQTEEGTDVEDKELNLVTKMEAEIGEESSQSPVESSAMEIENKIENLDQCSKNANT
HVSQGGKDMDASNVKE
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcagggcgcgggaccgccggcggcggcagcagcagcagcagcagcagcggcag
gagcggggcggcggagccggcggcggcgaccaggcgggctgggccggcggctaccccgag
atcgtgaaggagaacgagctgttcgagcggtactaccgggagctgggtatcgtacccgcc
ggagagtgggacgcgttcatggcggcgctgcgggagcctctccccgccacgctgcgcatc
accggctaccgcagccacgccaaagagattctccactgcttgaaggaaaagtacttccga
gagctgcaggacctggaggtggatggccaaaaagtcgagatgccgcagttgctgagctgg
tatcctgaagagttagcctggcacactaacttgagtagaaaaatcttacgcaagtcccca
caactggaaaaattgcatcaatttctggttagcgagacagaatgtggaaatatcagtcgt
caggaggctgttagtatgatcccacctctactgcttaatgttagccctcatcataaaatt
ctagatatgtgtgctgctcctggatctaagactgcacaactcattgaaatgttgcatgca
gacatgaatgttccttttcccaatggttttgtaattgccaatgatgtcgacaacaagcgc
tgctatttgctggttcaccaggctaagagattaaacagtccatgcatcatggtggtaaat
catgatgcctccagcattcctaacctgcaaatagatgttgatggaagaaaagagatcctt
ttctatgacaggattttatgtgatgtcccctgcagtggagatggaaccctgaggaaaaac
attgatgtgtggaagaagtggacaacacaaaacagtttgcagctccatggattgcagttg
agaattgcaacccgtggtgctgaacaactggcagaaggtgggagaatggtgtattccacg
tgttccttgaatcccattgaaaatgaagctgtgattgcctctctgctggaaaagagtcaa
ggtgccttagaacttgctgatgtctcttctgagttaccaggtttgaagaggatgccagga
attacaaaatggaaggtgatgctgaaagatggacagtggtttgaggagtggaaagatgtg
ccttcaaatagacaaacgcaaatacgtcctagtatgtttccagtgaaagatgcagagaag
ctaaaggcaatgaatctggagcgctgtcttaggatattgccacatcaccagaacacaggt
ggcttctttgtggctgtcttaataaaaaagtctccaatgccatggaataaacgtctgcct
aaggttcatcagaaattaccacaaagaacaagagatactgaagtgacagcagctaattca
gataatggttctgactgtattattgaagaaccaacactttctgaaaatgaagagtctaag
aaaatgcaagaattgcagaatttggacactgagcagagtaaaaaggaaggagtgtgcgga
ccaccaccatctaaaaaaatgaagttgtttggttttaaagaagacccttttgtgtttctt
cctgaagatgatccattgttccttcctatccagaggttttatgcattggacccatcattt
cccaagatgaatttgctcactcgaactcaagaaggaaaaaagaggcagctgtacatggtt
tctaaggagttaaggaatgtgcttctgaacaatagtgagaagatgaaggttatcaacaca
gggataaaagtctggtctcgcaacagtgatggtgaacagtttggatgtgcattcagatta
gcacaagagggaatttatactctgtacccattcattcatgcaagaattatagatgtctgc
atagaagatgtcaaaattctgctaacccaggaaaatccattcttaagtaaatttagcagt
gaaacacaaaagaaagtcaaagatatggcgatgggaagtatagttctgaagtacaaccca
gcccctgaaaaacctcatgatcttcagtgtccaatagtgctgtgtggttggcaagggaag
acctcactacgtgcctttgtgcccaagaatgagagacttcattacctgaggatgatggga
gttgaagtgtttaaagccaagaggaaagaggaactggaaaacaaaactgaggaagaagtt
caagagagactggagcaaactgaggaaggaacggatgtggaagataaagaacttaattta
gtcacaaaaatggaagcagaaataggtgaagagtcttctcagagtcctgtggaaagcagt
gctatggaaatagaaaataaaattgagaatttagatcaatgtagtaaaaatgccaacact
catgtaagccagggaggcaaagacatggatgcaagtaatgtgaaagagtag

DBGET integrated database retrieval system