KEGG   Parus major (Great Tit): 107203117
Entry
107203117         CDS       T04864                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00230  Purine metabolism
pmaj00240  Pyrimidine metabolism
pmaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107203117 (DCK)
   00240 Pyrimidine metabolism
    107203117 (DCK)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107203117 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 AAA_33 DUF5066
Other DBs
NCBI-GeneID: 107203117
NCBI-ProteinID: XP_015480127
Position
4
AA seq 340 aa
MATPPKRCRRLKKVAVEGNIAAGKSTFVNILKQASEEWEVVFEPVARWCNVQQSSGDDCE
ELTTSQKSGGNVLRMMYEKPERWAFTFQTYACLSRIRAQLNALDGKLRDAQDPVLFFERS
VYSDRYIFAANLYESDCMNETEWTIYQDWHDWINKQFGSRLALDGIIYLRATPEKCLNRI
YLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTDFDYLQEIPILTLDVNEDFKGKKDRY
DHMIEKVKFHSSTNSSSAPYPLIILLKYVSHSSIQVRNSSTAYGDTYLKARPNLYRLTAQ
EFGTGIPVGFKRGQLDFDLSSCNDLQTSAVVCTHFSIVQK
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagcgctgcaggcgcctcaagaaggtcgccgtggagggcaacatc
gctgcagggaaatccacctttgtgaatatcctgaaacaagccagcgaagagtgggaagtg
gttttcgagcctgtagctagatggtgcaatgtccagcaaagctctggagacgactgtgag
gagctgaccacgtcgcagaagagcggcgggaacgtgctgcggatgatgtacgagaagccg
gagcgctgggcgttcaccttccagacgtacgcgtgcctcagcaggatccgggctcagctc
aacgccctggatggcaaactccgcgatgcgcaggatcccgtgctgttcttcgagcgctcc
gtctacagcgacaggtacatctttgctgctaatctgtacgagtctgactgcatgaatgag
accgagtggacaatttaccaggactggcacgactggataaataaacagtttggctcccgg
ctggcgctggatgggatcatttatctccgagccactcctgagaaatgcttgaataggatt
tatttgcgtggaagagatgaggagcaagaaatccccattgaatatctggagaagcttcac
tacaagcacgaaagctggctccagcacaggacactgcgaacagattttgactatctacag
gaaattcccattttaacgctcgatgttaacgaagacttcaaaggcaaaaaggacagatac
gatcacatgattgaaaaggtaaaattccacagcagtacaaactcgtcaagtgcaccttac
cctctaatcatccttctgaaatatgtaagtcacagctccatccaggtaaggaacagttct
acagcctatggcgatacatatcttaaagccaggccaaacctttatcgtttaactgctcag
gagttcggtactggaatcccagtgggattcaagcgaggacagcttgactttgatctgagt
agctgcaatgacttacagacctcagcagtggtttgcacacatttttccattgttcagaaa
tga

DBGET integrated database retrieval system