KEGG   Parus major (Great Tit): 107203425Help
Entry
107203425         CDS       T04864                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial isoform X1
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj00020  Citrate cycle (TCA cycle)
pmaj00640  Propanoate metabolism
pmaj01100  Metabolic pathways
pmaj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107203425 (SUCLG1)
   00640 Propanoate metabolism
    107203425 (SUCLG1)
Enzymes [BR:pmaj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     107203425 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     107203425 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 107203425
NCBI-ProteinID: XP_015481018
Position
4
AA seq 345 aa AA seqDB search
MLPVCSFPLQAHFQISHSPGSLECSPQGPAGVQQNGVRHCSYTASRKNLYVNKSTKVICQ
GFTGKQGTFHSQQALEYGTNLVGGISPGKGGKTHLGLPVFNSVKEAKEQTGASATVIYVP
PPFAAAAINEAIDAEMPLVVCITEGIPQQDMVRVKHRLLRQSKTRLVGPNCPGVINPGEC
KIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSFCIGIGGDPFNGTNFIDCLD
VFLKDPQTEGIILIGEIGGNAEEDAAAFLKENNAGPNPKPVVSFIAGLTAPPGRRMGHAG
AIIAGGKGGAKEKIAALQSAGVVVSMSPAQLGSTIYKEFEKRKLL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctgtttgttctttccccttgcaggcccattttcaaatttcccattctcctgga
agcctggagtgttctccccaaggccctgctggtgttcaacagaatggagtccgacactgc
tcctacacagcatccaggaaaaacctgtatgtcaacaaaagcacaaaggttatctgtcag
ggttttacaggcaaacagggcacctttcacagccagcaggcgttggagtatggcaccaat
ctagttggaggaatttctccagggaaagggggaaaaactcatctaggtctgcctgtgttt
aattctgtgaaggaggccaaagaacaaacgggtgcttcagccactgtcatctacgtccct
cccccatttgcagctgctgccatcaacgaggccatcgatgcagagatgcccctggtggtg
tgcatcactgagggcatcccccagcaggacatggtgcgggtcaaacacaggctgctgcgg
cagagcaagacccggctggtgggccccaactgccccggagtcatcaatcctggagaatgt
aaaattggtatcatgcctggtcacattcacaagaaaggaagaattggtattgtgtcaaga
tctggaaccctgacatacgaagctgttcatcagacaacacaagttggcttggggcagtct
ttttgcattggtattggaggtgatcccttcaatggaactaattttattgactgccttgat
gtcttcctgaaagatcctcaaactgaggggataatattgattggggagattggaggaaat
gctgaagaagatgcagcggcatttttgaaagaaaataatgctggtcccaaccccaagcca
gtggtgtcattcatagccgggctgacggctcctccgggccggcggatgggccacgctgga
gccatcattgctgggggaaaggggggagccaaggagaagattgcagccctgcagagtgca
ggggttgtggtcagcatgtcccctgctcagctgggcagcaccatctacaaggagtttgag
aaaaggaaattgctgtaa

DBGET integrated database retrieval system