KEGG   Parus major (Great Tit): 107203917Help
Entry
107203917         CDS       T04864                                 

Gene name
NRK
Definition
(RefSeq) nik-related protein kinase isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
pmaj  Parus major (Great Tit)
Pathway
pmaj04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pmaj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107203917 (NRK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmaj01001]
    107203917 (NRK)
Enzymes [BR:pmaj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107203917 (NRK)
Protein kinases [BR:pmaj01001]
 Serine/threonine kinases: STE group
  STE20 family
   107203917 (NRK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 107203917
NCBI-ProteinID: XP_015482014
Position
4A
AA seq 1184 aa AA seqDB search
MNVTENEEEEIKLEINMLKKYSHHRNIATYYGAFVKKSPAGQDDQLWLVMEYCGAGSVTD
LVKKTKGNCFKEDWIAYICREVLRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVS
AQLDRTIGRRNTFIGTPYWMAPEVIACEENPDSTYDYRSDLWSLGITAIEMAEGAPPLCD
MHPMRALFLIPRNPPPKLKSRKWSKKFLNFVESCLVKHYLHRPSTETLLKHSFIRDMQNE
RQVRIMLKDHLDRTRKKKGEKEETDYDYSGSEEEDDELNEDEGEPSSIVNLPGESTLRRE
FLRLQQENKTRSDPHRQQQQLKDQEKYKKQLLAERQKRIEQQKEQRRRLEDHQKREQELR
RQQECEQRWPEAKVSHRKEERGKEDKRAVEDEYFIVDGQRKLEKKQMEDVQHNRKMHRTL
PKDQTQLLSLQHDHRQKKKEPSKTSNAGVHPPLSSTSKEAEDQRGAKKSDSIQPSLQWPV
ALGHEATPQPRMGSGSSSSPCTPAPQRALVVQCDSFRASKDVYHSSSLSDMVTAPLSPGQ
DDVFWSVSHSKEQPPKVPERTTSKFYSRDQPGPQRCLSSNTHQSSPGGHALKLNSSSSTP
GTKQWEMGSHQSSWSTSGNPGLAKAENVLSQNHMLLHQKPEKVSHPGQIASPGSFAKVKD
SANSLLKAADYSSSSDEVSSSSSSSSDEDDTNHTRQLLSGRIADFSRTRVPDGIELKPQS
TVAEQKDQILVKQIPNTQEGLWSINNQNYLLPDLLQQSQITDSSVNPPQVPLTCQEPQNK
PLTKSPCAESPPAKSSTSSTTSFTSFIDPRLLPITPPTSPVGPSCSSPSSAKPEPVRREN
ARKGSVVNVNPTNIRPQSDSPEIRKYKKKFNSEVLCAALWGVNLLVGTENGLWLLDRSGQ
GRVYTLITRRRFQQMDVLEGLNVLITISGKKNKLRVYYLSWLRNKILRNDPEVEKRQGWV
SVGDLEGCVHYKVVKYERIKFLVIALKNSVEVYAWAPKPYHKFMAFKSFTSLHHKPLSVD
LTVENGQRLKVIYGSVVGFHAIDVDSGSVYDLYLPTHIQGTIRPHAIIILPNTSGMELLL
TYEDEGIYIDIYGHFTKETVLQWGEMPASVAYLQSNQVMGWGEKAIELRSVETGNLEGVF
MHKKAQKLKFLCERNDKVFFASVQSGGSSQIYFMTLGQNVLFNW
NT seq 3555 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttactgagaatgaagaggaggaaatcaagctggagataaatatgttaaaaaag
tactcccatcaccggaatattgctacatattatggggcttttgtaaagaaaagtcctgca
ggccaggatgatcagctctggctggtgatggagtactgtggtgcgggctctgtcactgac
ttggtaaagaagacaaaagggaactgtttcaaggaagactggattgcttacatctgcaga
gaggttctcaggggattggcacatcttcatgctcatcatgtcatccatcgagatattaaa
ggacagaatgttcttcttacagaaaatgcagaagtaaaattggtggattttggtgtaagt
gctcagctggacaggactattgggagaagaaacacatttattggcaccccgtattggatg
gcacccgaggtcattgcgtgtgaggaaaacccagactctacatatgattacagaagtgac
ctgtggtctctgggaatcactgctattgaaatggctgaaggagcacctcccctgtgtgac
atgcatcccatgagagcactcttcctcatcccaaggaacccacctccaaagttgaaatcc
agaaaatggtcgaagaagttcctaaattttgttgaaagctgccttgtaaagcattatttg
catcgcccatccacggagaccctgctaaagcattccttcatccgagacatgcagaacgag
cggcaagtgcgcatcatgctgaaggatcacctggacaggacaaggaagaaaaaaggagaa
aaggaagaaacagactatgattacagtggaagtgaggaggaagatgatgagctgaatgaa
gatgaaggagaaccaagctccatagttaatctgccaggggagtcaactctccgccgtgaa
tttctgaggctgcagcaggagaacaaaacccgttcagaccctcatcggcagcagcagcag
ctgaaggaccaggagaagtacaagaaacagctgctggcagagcggcagaagcgcatcgag
cagcagaaggagcagaggaggaggctggaggatcaccagaagagagagcaggagctacga
aggcagcaggagtgtgagcagaggtggccagaggcaaaggtcagtcacaggaaagaggaa
aggggtaaagaagacaaaagggctgtggaagatgaatacttcatagtagatggacagagg
aaattagagaagaagcagatggaagatgtgcagcacaacaggaagatgcaccgaactctc
cccaaagatcagacacagctgctgtctctccagcatgatcacaggcagaagaagaaggag
ccttccaagacttcaaatgcaggagtgcatcctccattaagcagcacaagcaaagaggcc
gaggaccaaagaggagcaaagaagagtgacagcatccagccctccctgcagtggccagtg
gcgctgggacacgaggccaccccacagcccaggatgggatccgggagcagctccagcccc
tgcacccccgcaccacagcgagccctggtagtgcagtgtgacagtttccgggctagtaag
gatgtgtaccacagcagctctctgtcagacatggtgacagcaccgctcagccccggccag
gacgacgtgttctggagcgtgagccacagcaaagagcagcccccaaaggttccagaaagg
acaacctcgaaattctacagcagggatcagcctggccctcagagatgcctttcaagtaat
actcatcagtcatccccggggggacatgctctgaagctgaacagtagcagcagcactcct
ggcaccaagcagtgggagatgggatctcatcagagcagctggtcaacctcagggaatcca
ggacttgccaaggcagagaatgttttgtcccagaaccacatgttgttgcatcagaagcct
gaaaaagtttctcatccaggccagattgcaagtccaggctcctttgccaaggtgaaggac
agtgccaactccttgttaaaagcagcagactattcctcctcaagtgacgaagtcagcagc
agcagcagcagcagcagtgatgaagatgacacaaaccacacaaggcaactgctaagcggc
agaattgcagatttctcaaggacaagggtaccagatggaattgaactgaaaccccaaagc
accgtggcagaacagaaggatcagattttagtgaaacaaattccaaacacccaagaaggc
ctttggagcataaacaatcagaactatctcctgccagatctcctccagcaaagccaaatt
acagattcctctgtgaacccgccacaagtgccactgacttgccaggaacctcagaacaaa
cctctgacaaagagcccatgtgctgaaagcccacctgccaagagcagtacatcctccaca
acatccttcacatcattcatagatccaagacttctgccaatcacccctcccaccagtcca
gtaggaccttcctgtagttctccatctagtgccaaacctgagcctgtcaggagggaaaat
gcaaggaagggctccgttgtcaatgtcaatccaaccaatatccgcccacaaagtgacagc
ccagaaatccgtaaatacaagaagaaattcaactctgaggtcctgtgtgctgctctgtgg
ggagtaaatttattggtgggaacagagaatggattgtggttgctggacagaagtgggcaa
ggaagagtttatacgctgattacaaggagacgcttccagcaaatggatgttctggaagga
cttaatgtgctaattactatatcagggaagaagaataaattgagggtgtattacttgtca
tggttgagaaataaaattttgcgcaacgatccagaggtggagaagcgacaaggctgggtg
tccgtgggtgatctggaaggctgtgtgcactacaaagttgtaaaatatgagagaatcaaa
ttccttgtaatcgctttgaaaaactcagtggaggtttatgcttgggctccaaagccttat
cacaaattcatggcttttaagtcctttacctcacttcatcacaaaccactgtcagttgac
ctgactgttgaaaatgggcaaagactaaaggtcatatatggctcagtagtgggatttcat
gccattgatgtggactctggatctgtgtatgacttgtaccttccaacacacatccagggg
accattcgcccacatgccattatcatcctcccgaacaccagtggcatggagctcctgctc
acctatgaagatgagggcatctacattgatatatatgggcatttcacaaaggagactgtt
ctgcagtggggagaaatgccagcatctgtagcttaccttcagtccaatcaggtcatgggc
tggggagaaaaagcaattgaactacgctctgtggaaacagggaatctggaaggagtattt
atgcacaagaaagcacagaagctaaaatttctatgtgaaagaaatgacaaggtgttcttt
gcttctgtacagtcaggaggcagcagtcaaatatactttatgactcttggtcaaaatgta
ctattcaactggtaa

DBGET integrated database retrieval system